RegulonDB RegulonDB 10.6.3: Gene Form
   

ynjE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjE ynjD ynjF ynjEp ynjEp

Gene      
Name: ynjE    Texpresso search in the literature
Synonym(s): ECK1755, G6952, b1757
Genome position(nucleotides): 1839467 --> 1840774 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.52
External database links:  
ASAP:
ABE-0005848
ECHOBASE:
EB3763
ECOCYC:
G6952
ECOLIHUB:
ynjE
OU-MICROARRAY:
b1757
REGULONDB:
b1757
STRING:
511145.b1757
M3D: ynjE
COLOMBOS: ynjE
PortEco: b1757


Product      
Name: molybdopterin synthase sulfurtransferase
Synonym(s): YnjE, YnjE sulfurtransferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 48.229
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
179 -> 263 KLYLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAAARVAQIMLYAGVKDVRLLDGGWQTWSD
385 -> 385 C
24 -> 435 AELAKPLTLDQLQQQNGKAIDTRPSAFYNGWPQTLNGPSGHELAALNLSASWLDKMSTEQLNAWIKQHNLKTDAPVALYGNDKDVDAVKTRLQKAGLTHISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQQGKEVTAKPAGDWKVIEAAWGAPKLYLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAAARVAQIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPDFGVKIPAQPQLMLDMEQARGLLHRQDASLVSIRSWPEFIGTTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTMRSADDITAMWKAWNIKPEQQVSFYCGTGWRASETFMYARAMGWKNVSVYDGGWYEWSSDPKNPVATGERGPDSSK
164 -> 270 PAGDWKVIEAAWGAPKLYLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYAAARVAQIMLYAGVKDVRLLDGGWQTWSDAGLPVER
36 -> 138 QQQNGKAIDTRPSAFYNGWPQTLNGPSGHELAALNLSASWLDKMSTEQLNAWIKQHNLKTDAPVALYGNDKDVDAVKTRLQKAGLTHISILSDALSEPSRLQK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
molecular_function GO:0016740 - transferase activity
GO:0016783 - sulfurtransferase activity
GO:0004792 - thiosulfate sulfurtransferase activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12782N
ECOCYC:
G6952-MONOMER
ECOLIWIKI:
b1757
INTERPRO:
IPR001763
INTERPRO:
IPR001307
INTERPRO:
IPR036873
MODBASE:
P78067
PDB:
2WLR
PDB:
3IPP
PDB:
3IPO
PDB:
2WLX
PFAM:
PF00581
PRIDE:
P78067
PROSITE:
PS51257
PROSITE:
PS50206
PROSITE:
PS00683
PROSITE:
PS00380
PROTEINMODELPORTAL:
P78067
REFSEQ:
NP_416271
SMART:
SM00450
SMR:
P78067
UNIPROT:
P78067


Operon      
Name: ynjE         
Operon arrangement:
Transcription unit        Promoter
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB