RegulonDB RegulonDB 10.9: Gene Form
   

yeaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gapA yeaD yeaE terminator anti-terminator anti-anti-terminator TSS_2120 TSS_2120 TSS_2119 TSS_2119 TSS_2118 TSS_2118 TSS_2117 TSS_2117 TSS_2116 (cluster) TSS_2116 (cluster) TSS_2115 TSS_2115 TSS_2114 TSS_2114 TSS_2113 TSS_2113 TSS_2112 (cluster) TSS_2112 (cluster) TSS_2111 (cluster) TSS_2111 (cluster) TSS_2110 TSS_2110 TSS_2109 TSS_2109 TSS_2108 TSS_2108 TSS_2107 TSS_2107 TSS_2106 (cluster) TSS_2106 (cluster) TSS_2105 TSS_2105 TSS_2104 TSS_2104 TSS_2103 (cluster) TSS_2103 (cluster) TSS_2102 TSS_2102 TSS_2101 TSS_2101 TSS_2100 TSS_2100 TSS_2099 TSS_2099 TSS_2098 TSS_2098 TSS_2097 TSS_2097 TSS_2096 TSS_2096 TSS_2095 (cluster) TSS_2095 (cluster) TSS_2094 TSS_2094 TSS_2093 (cluster) TSS_2093 (cluster) TSS_2092 TSS_2092 TSS_2091 TSS_2091 TSS_2090 TSS_2090 TSS_2089 TSS_2089 TSS_2088 TSS_2088 TSS_2087 (cluster) TSS_2087 (cluster) TSS_2086 (cluster) TSS_2086 (cluster) TSS_2085 TSS_2085

Gene      
Name: yeaD    Texpresso search in the literature
Synonym(s): ECK1778, G6966, b1780, yzzQ
Genome position(nucleotides): 1863850 --> 1864734 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.83
External database links:  
ASAP:
ABE-0005923
ECHOBASE:
EB2544
ECOLIHUB:
yeaD
OU-MICROARRAY:
b1780
STRING:
511145.b1780
COLOMBOS: yeaD


Product      
Name: putative aldose 1-epimerase YeaD
Synonym(s): YeaD, YzzQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.666
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
27 -> 273 DLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLWLSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHHEDADGVALTFELTQSEETKKFWPHDFTLLAHFRVGKTCEIDLESHGEFETTSALHTYFNVGDIAKVSVSGLGDRFIDKVNDAKENVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVVGWNPGPALSISMGDMPDDGYKTFVCVETAYASE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0030246 - carbohydrate binding
GO:0047938 - glucose-6-phosphate 1-epimerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6966-MONOMER
ECOLIWIKI:
b1780
INTERPRO:
IPR011013
INTERPRO:
IPR025532
INTERPRO:
IPR014718
INTERPRO:
IPR008183
MODBASE:
P39173
PFAM:
PF01263
PRIDE:
P39173
REFSEQ:
NP_416294
SMR:
P39173
UNIPROT:
P39173


Operon      
Name: gapA-yeaD         
Operon arrangement:
Transcription unit        Promoter
gapA
gapA
gapA
gapA
gapA-yeaD
gapA
gapA
yeaD


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2085 1862771 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2086 (cluster) 1862774 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2087 (cluster) 1862788 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2088 1862797 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2089 1862804 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2090 1862847 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2091 1862947 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2092 1862959 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2093 (cluster) 1862961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2094 1863001 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2095 (cluster) 1863006 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2096 1863012 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2097 1863021 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2098 1863027 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2099 1863087 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2100 1863184 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2101 1863237 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2102 1863241 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2103 (cluster) 1863253 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2104 1863264 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2105 1863314 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2106 (cluster) 1863369 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2107 1863446 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2108 1863455 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2109 1863467 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2110 1863477 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2111 (cluster) 1863480 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2112 (cluster) 1863483 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2113 1863495 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2114 1863581 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2115 1863598 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2116 (cluster) 1863618 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2117 1863646 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2118 1863824 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2119 1863836 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2120 1864487 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB