RegulonDB RegulonDB 10.8: Gene Form
   

yecH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrP ftnA yecH TyrR TyrR anti-anti-terminator anti-terminator terminator yecHp5 yecHp5 tyrPp1 tyrPp1 yecHp3 yecHp3 TSS_2244 TSS_2244 TSS_2243 (cluster) TSS_2243 (cluster) tyrPp2 tyrPp2

Gene      
Name: yecH    Texpresso search in the literature
Synonym(s): ECK1905, G7036, b1906
Genome position(nucleotides): 1989251 <-- 1989490 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.08
External database links:  
ASAP:
ABE-0006344
ECHOBASE:
EB2705
OU-MICROARRAY:
b1906
PortEco:
yecH
STRING:
511145.b1906
COLOMBOS: yecH


Product      
Name: DUF2492 domain-containing protein YecH
Synonym(s): YecH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.629
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence
3 -> 78 SIHGHEVLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKGKFIPSKDGFSTDQSKICR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7036-MONOMER
ECOLIWIKI:
b1906
INTERPRO:
IPR019620
PFAM:
PF10678
PRIDE:
P46887
REFSEQ:
NP_416419
UNIPROT:
P46887


Operon      
Name: yecH         
Operon arrangement:
Transcription unit        Promoter
yecH


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2243 (cluster) 1989510 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2244 1989562 reverse nd [RS-EPT-CBR] [1]
  promoter yecHp3 1989564 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yecHp5 1989652 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB