RegulonDB RegulonDB 10.10: Gene Form
   

tcyJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: tcyJ    Texpresso search in the literature
Synonym(s): ECK1919, G7039, b1920, fliY, ssi7, yzzR
Genome position(nucleotides): 1999585 <-- 2000385 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.81
External database links:  
ASAP:
ABE-0006392
ECHOBASE:
EB2545
ECOLIHUB:
fliY
OU-MICROARRAY:
b1920
STRING:
511145.b1920
COLOMBOS: tcyJ


Product      
Name: cystine ABC transporter periplasmic binding protein
Synonym(s): FliY, Ssi7, TcyJ, YzzR
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,membrane
Molecular weight: 29.039
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
1 -> 29 MKLAHLGRQALMGVMAVALVAGMSVKSFA
30 -> 266 DEGLLNKVKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADVTK
44 -> 261 LVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016597 - amino acid binding
GO:0015276 - ligand-gated ion channel activity
GO:0015184 - L-cystine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0006791 - sulfur utilization
GO:0034220 - ion transmembrane transport
GO:0015811 - L-cystine transport
GO:0015830 - diaminopimelate transport
Note(s): Note(s): ...[more].
Reference(s): [1] Berger EA., et al., 1972
External database links:  
DIP:
DIP-47980N
ECOCYC:
G7039-MONOMER
ECOLIWIKI:
b1920
INTERPRO:
IPR001638
INTERPRO:
IPR018313
INTERPRO:
IPR001320
MODBASE:
P0AEM9
PFAM:
PF00497
PRIDE:
P0AEM9
PRODB:
PRO_000022670
PROSITE:
PS01039
REFSEQ:
NP_416430
SMART:
SM00062
SMART:
SM00079
SMR:
P0AEM9
UNIPROT:
P0AEM9


Operon      
Name: fliAZ-tcyJ         
Operon arrangement:
Transcription unit        Promoter
tcyJ
fliAZY
fliAZY


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, H-NS, FlhDC
Repressed by: NsrR, SutR, MatA, IHF, CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2251 2000146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2252 2000154 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2253 2000191 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2254 2000398 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2256 (cluster) 2000468 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2257 2000470 reverse nd [RS-EPT-CBR] [2]



RegulonDB