RegulonDB RegulonDB 10.9: Gene Form
   

insH6 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: insH6    Texpresso search in the literature
Synonym(s): ECK0261, G7074, b1994, trs5-6, yi52_6
Genome position(nucleotides): 2066305 <-- 2067285 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.94
External database links:  
ASAP:
ABE-0006619
ECHOBASE:
EB4730
ECOLIHUB:
insH-6
OU-MICROARRAY:
b1994
STRING:
511145.b1994
COLOMBOS: insH6


Product      
Name: CP4-44 prophage; IS5 transposase and trans-activator
Synonym(s): InsH6, Trs5-6, Yi52_6
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.823
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRAKVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7074-MONOMER
ECOLIWIKI:
b1994
INTERPRO:
IPR008490
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF05598
PRIDE:
P0CE53
PRODB:
PRO_000023022
REFSEQ:
NP_416498
UNIPROT:
P0CE53


Operon      
Name: insH6         
Operon arrangement:
Transcription unit        Promoter
insH6


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2304 2065847 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2305 2065996 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2306 2067312 reverse nd [RS-EPT-CBR] [1]
  promoter insHp2 2067498 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2067511 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2307 2067918 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2308 2067920 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2309 2067984 forward nd [RS-EPT-CBR] [1]



RegulonDB