RegulonDB RegulonDB 10.8: Gene Form
   

yegV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yegT yegU yegV yegX yegW

Gene      
Name: yegV    Texpresso search in the literature
Synonym(s): ECK2093, G7132, b2100
Genome position(nucleotides): 2181096 --> 2182061 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.94
External database links:  
ASAP:
ABE-0006950
ECHOBASE:
EB3818
OU-MICROARRAY:
b2100
PortEco:
yegV
STRING:
511145.b2100
COLOMBOS: yegV


Product      
Name: putative sugar kinase YegV
Synonym(s): YegV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.385
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence
17 -> 306 QSVMVVGAAVIDVIADAYALPWRGCDIELKQQSVNVGGCALNIAVALKRLGIEAGNALPLGQGVWAEMIRNRMAKEGLISLIDNAEGDNGWCLALVEPDGERTFMSFSGVENQWNRQWLARLTVAPGSLLYFSGYQLASPCGELLVEWLEELQDVTPFIDFGPRIGDIPDALLARIMACRPLVSLNRQEAEIAAERFALSAEITTLGKQWQEKFAAPLIVRLDKEGAWYFSNDASGCIPAFPTQVVDTIGAGDSHAGGVLAGLASGLPLADAVLLGNAVASWVVGHRGGD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0019200 - carbohydrate kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
biological_process GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11892N
ECOCYC:
G7132-MONOMER
ECOLIWIKI:
b2100
INTERPRO:
IPR011611
INTERPRO:
IPR029056
INTERPRO:
IPR002173
INTERPRO:
IPR002139
MODBASE:
P76419
PFAM:
PF00294
PRIDE:
P76419
PRINTS:
PR00990
PROSITE:
PS00584
PROSITE:
PS00583
REFSEQ:
NP_416603
SMR:
P76419
UNIPROT:
P76419


Operon      
Name: yegTUV         
Operon arrangement:
Transcription unit        Promoter
yegTUV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB