RegulonDB RegulonDB 10.8: Gene Form
   

yfaS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaS yfaA yfaQ yfaT yfaPp4 yfaPp4

Gene      
Name: yfaS    Texpresso search in the literature
Synonym(s): ECK2220, G7155, b2227, b2228, b4500, yfaR
Type: Pseudo Gene
Genome position(nucleotides): 2329798 <-- 2334402 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.72
External database links:  
ASAP:
ABE-0007362
ASAP:
ABE-0007364
ASAP:
ABE-0285101
OU-MICROARRAY:
b2227
OU-MICROARRAY:
b2228
PortEco:
yfaS_1
PortEco:
yfaS_2
COLOMBOS: yfaS


Product      
Name: putative macroglobulin family protein, N-terminal fragment
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 6.737
Motif(s):
 
Type Positions Sequence
1 -> 38 MDTQRFQSQFHWHLSFKFSGAIAACLSLSLVGTGLANA
39 -> 1367 DDSLPSSNYAPPAGGTFFLLADSSFSSSEEAKVRLEAPGRDYRRYQMEEYGGVDVRLYRIPDPMAFLRQQKNLHRIVVQPQYLGDGLNNTLTWLWDNWYGKSRRVMQRTFSSQSRQNVTQALPELQLGNAIIKPSRYVQNNQFSPLKKYPLVKQFRYPLWQAKPFEPQQGVKLEGASSNFISPQPGNIYIPLGQQEPGLYLVEAMVGGYRATTVVFVSDTVALSKVSGKELLVWTAGKKQGEAKPGSEILWTDGLGVMTRGVTDDSGTLQLQHISPERSYILGKDAEGGVFVSENFFYESEIYNTRLYIFTDRPLYRAGDRVDVKVIGREFHDPLHSSPIVSAPAKLSVLDANGSLLQTVNVTLDARNGGQGSFRLPENAVAGGYELRLAYRNQVYSSSFRVANYIKPHFEIGLALAKKEFKTGEAVSGKLQLLYPDGEPVKNARVQLSLRAQQLSMVGNDLRYAGRFPVSLEGSETVSDASGHVALNLPAADKPSRYLLTVSASDGAAYRVTTTKEILIERGLAHYSLSTAAQYSNSGESVVFRYAALESSKQVPVTYEWLRLEDRTSHSGELPSGGKSFTVNFAKPGNYNLTLRDKDGLILAGLSHAVSGKGSTAHTGTVDIVADKTLYQPGETAKMLITFPEPIDEALLTLERDRVEQQSLLSHPANWLTLQRLNDTQYEARVPVSNSFAPNITFSVLYTRNGQYSFQNAGIKVAVPQLDIRVKTDKTHYQPGELVNVELTSSLKGKPVSAQLTVGVVDEMIYALQPEIAPNIGKFFYPLGRNNVRTSSSLSFISYDQALSSEPVAPGATNRSERRVKMLERPRREEVDTAAWMPSLTTDKQGKAYFTFLMPDSLTRWRITARGMNGDGLVGQGRAYLRSEKNLYMKWSMPTVYRVGDKPAAGLFIFSQQDNEPVALVTKFAGAEMRQTLTLHKGANYISLTQNIQQSGLLSAELQQNGQVQDSISTKLSFVDNSWPVEQQKNVMLGGGDNALMLPEQASNIRLQSSETPQEIFRNNLDALVDEPWGGVINTGSRLIPLSLAWRSLADHQSAAANDIRQMIQDNRLRLMQLAGPGARFTWWGEDGNGDAFLTAWAWYADWQASQAIGVTQQPEYWQHMLDSYAEQADNMPLLHRALVLAWAQEMNLPCKTLLKGLDEAIARRGTKTEDFSEEDTRDINDSLILDTPESPLADAVANVLTMTLLKKAQLKSTVMPQVQQYAWDKAANSNQPLAHTVVLLNSGGDATQTAAILSGLTAEQSTIERALAMNWLAKYMATMPPVVLPAPAGAWAKHKLTGGGEDWRWVGQGVPDILSFGDELSPQNVQVR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7155-MONOMER
ECOLIWIKI:
b2228
MODBASE:
P76464
UNIPROT:
P76464


Operon      
Name: yfaATSQP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaPp4 2328199 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB