RegulonDB RegulonDB 10.8: Gene Form
   

yfdM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfdL yfdN yfdK yfdO yfdM tfaS

Gene      
Name: yfdM    Texpresso search in the literature
Synonym(s): ECK2350, G7225, b2356, yzyB
Genome position(nucleotides): 2472112 <-- 2472387 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.54
External database links:  
ASAP:
ABE-0007775
ECHOBASE:
EB2784
ECOO157CYC:
Z3349
ECOO157CYC:
Z1454
OU-MICROARRAY:
b2356
PortEco:
yfdM
STRING:
316407.85675370
COLOMBOS: yfdM


Product      
Name: CPS-53 (KpLE1) prophage; putative methyltransferase
Synonym(s): YfdM, YzyB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.336
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence
17 -> 89 AHELKEVGDQWRTPDNIFWGINTLFGPFVLDLFTDGDNAKCAAYYTAEDNALAHDWSERLAELKGAAFGNPPY

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0009007 - site-specific DNA-methyltransferase (adenine-specific) activity
biological_process GO:0032259 - methylation
GO:0032775 - DNA methylation on adenine
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7225-MONOMER
ECOLIWIKI:
b2356
ECOO157CYC:
Z3349-MONOMER
ECOO157CYC:
Z1454-MONOMER
INTERPRO:
IPR008593
PFAM:
PF05869
PRIDE:
P76509
PROSITE:
PS00092
REFSEQ:
NP_416857
SMR:
P76509
UNIPROT:
P76509


Operon      
Name: yfdONMLK         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB