RegulonDB RegulonDB 10.8: Gene Form
   

emrK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrY dsdA emrK evgL evgA EvgA TSS_2668 (cluster) TSS_2668 (cluster) evgAp1 evgAp1 TSS_2666 TSS_2666 evgAp2 evgAp2 TSS_2665 TSS_2665 emrKp emrKp emrYp1 emrYp1 TSS_2664 TSS_2664

Gene      
Name: emrK    Texpresso search in the literature
Synonym(s): ECK2364, G7233, b2368
Genome position(nucleotides): 2482176 <-- 2483339 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.92
External database links:  
ASAP:
ABE-0007808
ECHOBASE:
EB3067
OU-MICROARRAY:
b2368
PortEco:
emrK
STRING:
511145.b2368
COLOMBOS: emrK


Product      
Name: tripartite efflux pump membrane fusion protein EmrK
Synonym(s): EmrK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 42.585
Isoelectric point: 7.863
Motif(s):
 
Type Positions Sequence
30 -> 340 GAYAYWSMELEDMISTDDAYVTGNADPISAQVSGSVTVVNHKDTNYVRQGDILVSLDKTDATIALNKAKNNLANIVRQTNKLYLQDKQYSAEVASARIQYQQSLEDYNRRVPLAKQGVISKETLEHTKDTLISSKAALNAAIQAYKANKALVMNTPLNRQPQVVEAADATKEAWLALKRTDIKSPVTGYIAQRSVQVGETVSPGQSLMAVVPARQMWVNANFKETQLTDVRIGQSVNIISDLYGENVVFHGRVTGINMGTGNAFSLLPAQNATGNWIKIVQRVPVEVSLDPKELMEHPLRIGLSMTATIDT
17 -> 37 FSLLAVVLFIAFSGAYAYWSM
56 -> 285 PISAQVSGSVTVVNHKDTNYVRQGDILVSLDKTDATIALNKAKNNLANIVRQTNKLYLQDKQYSAEVASARIQYQQSLEDYNRRVPLAKQGVISKETLEHTKDTLISSKAALNAAIQAYKANKALVMNTPLNRQPQVVEAADATKEAWLALKRTDIKSPVTGYIAQRSVQVGETVSPGQSLMAVVPARQMWVNANFKETQLTDVRIGQSVNIISDLYGENVVFHGRVTGI

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0006974 - cellular response to DNA damage stimulus
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7233-MONOMER
ECOLIWIKI:
b2368
INTERPRO:
IPR032317
INTERPRO:
IPR006143
INTERPRO:
IPR005694
MODBASE:
P52599
PFAM:
PF00529
PFAM:
PF16576
PRIDE:
P52599
PROSITE:
PS00543
REFSEQ:
NP_416869
SMR:
P52599
UNIPROT:
P52599


Operon      
Name: emrKY         
Operon arrangement:
Transcription unit        Promoter
emrKY


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA, FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2664 2480013 forward nd [RS-EPT-CBR] [1]
  promoter emrYp1 2482334 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2665 2483630 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2666 2483632 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2668 (cluster) 2483646 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB