RegulonDB RegulonDB 10.8: Gene Form
   

yfdV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oxc yfdE yfdV anti-terminator terminator terminator

Gene      
Name: yfdV    Texpresso search in the literature
Synonym(s): ECK2368, G7235, b2372
Genome position(nucleotides): 2489242 <-- 2490186 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.76
External database links:  
ASAP:
ABE-0007824
ECHOBASE:
EB3896
OU-MICROARRAY:
b2372
PortEco:
yfdV
STRING:
511145.b2372
COLOMBOS: yfdV


Product      
Name: putative transport protein YfdV
Synonym(s): YfdV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.616
Isoelectric point: 9.136
Motif(s):
 
Type Positions Sequence
6 -> 161 IGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREMIFADTRLTLVSLVVIVGCFFFSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPIYGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKKN
131 -> 153 VAIISIIVNAITIPIGLYLLNPS
174 -> 196 PVVWAPVLATILVLVGVKIPAAW
200 -> 222 FNLIAKANSGVAVFAAGLTLAAH
261 -> 283 MMVLAGALPPAFSGIIIASRFNV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Riley M., et al., 2006
[2] Serres MH., et al., 2001
External database links:  
DIP:
DIP-28062N
ECOCYC:
B2372-MONOMER
ECOLIWIKI:
b2372
INTERPRO:
IPR004776
PFAM:
PF03547
PRIDE:
P0AA49
REFSEQ:
NP_416873
UNIPROT:
P0AA49


Operon      
Name: yfdX-frc-oxc-yfdVE         
Operon arrangement:
Transcription unit        Promoter
frc
yfdX
 


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Riley M., Abe T., Arnaud MB., Berlyn MK., Blattner FR., Chaudhuri RR., Glasner JD., Horiuchi T., Keseler IM., Kosuge T., Mori H., Perna NT., Plunkett G., Rudd KE., Serres MH., Thomas GH., Thomson NR., Wishart D., Wanner BL., 2006, Escherichia coli K-12: a cooperatively developed annotation snapshot--2005., Nucleic Acids Res 34(1):1-9

 [2] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035


RegulonDB