RegulonDB RegulonDB 10.8: Gene Form
   

pyrS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrS alaC pyrR SgrR terminator alaCp alaCp TSS_2671 TSS_2671

Gene      
Name: pyrS    Texpresso search in the literature
Synonym(s): ECK2376, G7243, b2380, ypdA
Genome position(nucleotides): 2498671 --> 2500368 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.41
External database links:  
ASAP:
ABE-0007855
ECHOBASE:
EB3900
OU-MICROARRAY:
b2380
PortEco:
ypdA
STRING:
511145.b2380
COLOMBOS: pyrS


Product      
Name: sensor histidine kinase PyrS
Synonym(s): PyrS, YpdA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 62.657
Isoelectric point: 7.761
Motif(s):
 
Type Positions Sequence
4 -> 24 IFNMLLAVFDRAALMLICLFF
173 -> 193 IGIPMILGSVCIGFIVLLVQS
343 -> 554 QLEVSRAEQLREMANKAELRALQSKINPHFLFNALNAISSSIRLNPDTARQLIFNLSRYLRYNIELKDDEQIDIKKELYQIKDYIAIEQARFGDKLTVIYDIDEEVNCCIPSLLIQPLVENAIVHGIQPCKGKGVVTISVAECGNRVRIAVRDTGHGIDPKVIERVEANEMPGNKIGLLNVHHRVKLLYGEGLHIRRLEPGTEIAFYIPNQR
108 -> 128 GVTAIPCFITSILAGCISGWI
140 -> 160 VGILGGMLCETLTMILVIVWA

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0018106 - peptidyl-histidine phosphorylation
GO:0071555 - cell wall organization
GO:0023014 - signal transduction by protein phosphorylation
GO:0031670 - cellular response to nutrient
Note(s): Note(s): ...[more].
Reference(s): [1] DeLisa MP., et al., 2001
[2] Oshima T., et al., 2002
[3] Tchieu JH., et al., 2001
External database links:  
ECOCYC:
G7243-MONOMER
ECOLIWIKI:
b2380
INTERPRO:
IPR003594
INTERPRO:
IPR036890
INTERPRO:
IPR029016
INTERPRO:
IPR011620
INTERPRO:
IPR010559
MODBASE:
P0AA93
PFAM:
PF06580
PFAM:
PF02518
PFAM:
PF07694
PRIDE:
P0AA93
PROSITE:
PS50109
REFSEQ:
NP_416881
SMART:
SM00387
SMR:
P0AA93
UNIPROT:
P0AA93


Operon      
Name: pyrSR-ypdC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2671 2498356 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] DeLisa MP., Wu CF., Wang L., Valdes JJ., Bentley WE., 2001, DNA microarray-based identification of genes controlled by autoinducer 2-stimulated quorum sensing in Escherichia coli., J Bacteriol 183(18):5239-47

 [2] Oshima T., Aiba H., Masuda Y., Kanaya S., Sugiura M., Wanner BL., Mori H., Mizuno T., 2002, Transcriptome analysis of all two-component regulatory system mutants of Escherichia coli K-12., Mol Microbiol 46(1):281-91

 [3] Tchieu JH., Norris V., Edwards JS., Saier MH., 2001, The complete phosphotransferase system in Escherichia coli., J Mol Microbiol Biotechnol 3(3):329-46

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB