RegulonDB RegulonDB 10.8: Gene Form
   

fryA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fryA ypdE ypdC fryAp6 fryAp6

Gene      
Name: fryA    Texpresso search in the literature
Synonym(s): ECK2379, G7246, b2383, ypdD
Genome position(nucleotides): 2501990 <-- 2504485 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.21
External database links:  
ASAP:
ABE-0007861
ECHOBASE:
EB3903
OU-MICROARRAY:
b2383
PortEco:
fryA
STRING:
511145.b2383
COLOMBOS: fryA


Product      
Name: putative PTS multiphosphoryl transfer protein FryA
Synonym(s): FryA, TTP, YpdD, triphosphoryl transfer protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 92.13
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
685 -> 828 PLLALENIFVDQDFSNKEQAIQFLCGNLGVNGRTEHPFELEEDVWQREEIVTTGVGFGVAIPHTKSQWIRHSSISIARLAKPIGWQSEMGEVELVIMLTLGANEGMNHVKVFSQLARKLVNKNFRQSLFAAQDAQSILTLLETE
563 -> 564 ND
7 -> 83 LCPLPNGLHARPAWELKEQCSQWQSEITFINHRQNAKADAKSSLALIGTGTLFNDSCSLNISGSDEEQARRVLEEYI
360 -> 650 KQQAQAAAQLAYSRDNKRIDIAANIGTALEAPGAFANGAEGVGLFRTEMLYMDRDSAPDEQEQFEAYQQVLLAAGDKPIIFRTMDIGGDKSIPYLNIPQEENPFLGYRAVRIYPEFAGLFRTQLRAILRAASFGNAQLMIPMVHSLDQILWVKGEIQKAIVELKRDGLRHAETITLGIMVEVPSVCYIIDHFCDEVDFFSIGSNDMTQYLYAVDRNNPRVSPLYNPITPSFLRMLQQIVTTAHQRGKWVGICGELGGESRYLPLLLGLGLDELSMSSPRIPAVKSQLRQLD
687 -> 826 LALENIFVDQDFSNKEQAIQFLCGNLGVNGRTEHPFELEEDVWQREEIVTTGVGFGVAIPHTKSQWIRHSSISIARLAKPIGWQSEMGEVELVIMLTLGANEGMNHVKVFSQLARKLVNKNFRQSLFAAQDAQSILTLLE

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0008965 - phosphoenolpyruvate-protein phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12817N
ECOCYC:
G7246-MONOMER
ECOLIWIKI:
b2383
INTERPRO:
IPR036637
INTERPRO:
IPR036618
INTERPRO:
IPR000032
INTERPRO:
IPR000121
INTERPRO:
IPR002178
INTERPRO:
IPR004715
INTERPRO:
IPR006318
INTERPRO:
IPR008279
INTERPRO:
IPR008731
INTERPRO:
IPR015813
INTERPRO:
IPR016152
INTERPRO:
IPR023151
INTERPRO:
IPR035895
INTERPRO:
IPR040442
MODBASE:
P77439
PANTHER:
PTHR22931:SF10
PFAM:
PF05524
PFAM:
PF00359
PFAM:
PF00381
PFAM:
PF00391
PFAM:
PF02896
PRIDE:
P77439
PRINTS:
PR01736
PRODB:
PRO_000022707
PROSITE:
PS00742
PROSITE:
PS51094
PROSITE:
PS51350
REFSEQ:
NP_416884
SMR:
P77439
SWISSMODEL:
P77439
UNIPROT:
P77439


Operon      
Name: fryBC-ypdFE-fryA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter fryAp6 2504493 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB