RegulonDB RegulonDB 10.8: Gene Form
   

yfhR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csiE yfhR suhB hcaT CRP csiEp csiEp yfhRp2 yfhRp2 yfhRp4 yfhRp4

Gene      
Name: yfhR    Texpresso search in the literature
Synonym(s): ECK2531, G7328, b2534
Genome position(nucleotides): 2664390 --> 2665244 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.53
External database links:  
ASAP:
ABE-0008340
ECHOBASE:
EB3226
OU-MICROARRAY:
b2534
PortEco:
yfhR
STRING:
511145.b2534
COLOMBOS: yfhR


Product      
Name: putative peptidase
Synonym(s): YfhR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.516
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
12 -> 32 ILFILFVVAFCVYLVPRVAIN
9 -> 29 VPKILFILFVVAFCVYLVPRV
77 -> 187 AIATIIHAHGNAGNMSAHWPLVSWLPERNFNVFMFDYRGFGKSKGTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANILDVIGRGDREGIRAVILDSTFASYA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7328-MONOMER
ECOLIWIKI:
b2534
INTERPRO:
IPR022742
INTERPRO:
IPR029058
MODBASE:
P77538
PFAM:
PF12146
PRIDE:
P77538
REFSEQ:
NP_417029
SMR:
P77538
UNIPROT:
P77538


Operon      
Name: yfhR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfhRp4 2664204 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yfhRp2 2664244 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB