RegulonDB RegulonDB 10.8: Gene Form
   

hcaR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaE hcaT hcaR iroK csiE hcaF HcaR terminator hcaEp hcaEp hcaRp hcaRp hcaTp7 hcaTp7 hcaTp6 hcaTp6 hcaTp1 hcaTp1

Gene      
Name: hcaR    Texpresso search in the literature
Synonym(s): ECK2534, G7331, b2537, phdR, yfhT
Genome position(nucleotides): 2668006 <-- 2668896 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.83
External database links:  
ASAP:
ABE-0008351
ECHOBASE:
EB3228
OU-MICROARRAY:
b2537
PortEco:
hcaR
STRING:
511145.b2537
COLOMBOS: hcaR


Product      
Name: DNA-binding transcriptional dual regulator HcaR
Synonym(s): HcaR, PhdR, YfhT
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 32.838
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
145 -> 148 MRHP
1 -> 58 MELRHLRYFVAVAQALNFTRAAEKLHTSQPSLSSQIRDLENCVGVPLLVRDKRKVALT
18 -> 38 FTRAAEKLHTSQPSLSSQIRD
127 -> 141 ITTQQEEKIRRGELD
3 -> 62 LRHLRYFVAVAQALNFTRAAEKLHTSQPSLSSQIRDLENCVGVPLLVRDKRKVALTAAGE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Reference(s): [1] Diaz E., et al., 1998
[2] Turlin E., et al., 2005
External database links:  
ECOCYC:
G7331-MONOMER
ECOLIWIKI:
b2537
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
Q47141
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
Q47141
PRINTS:
PR00039
PRODB:
PRO_000022863
PROSITE:
PS50931
REFSEQ:
NP_417032
SMR:
Q47141
UNIPROT:
Q47141


Operon      
Name: hcaR         
Operon arrangement:
Transcription unit        Promoter
hcaR


Transcriptional Regulation      
Display Regulation             
Repressed by: HcaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hcaTp1 2667863 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter hcaTp6 2667928 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter hcaTp7 2668053 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Diaz E., Ferrandez A., Garcia JL., 1998, Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12., J Bacteriol 180(11):2915-23

 [2] Turlin E., Sismeiro O., Le Caer JP., Labas V., Danchin A., Biville F., 2005, 3-phenylpropionate catabolism and the Escherichia coli oxidative stress response., Res Microbiol 156(3):312-21

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB