RegulonDB RegulonDB 10.8: Gene Form
   

hcaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaD hcaB yphA hcaC TSS_2835 TSS_2835

Gene      
Name: hcaD    Texpresso search in the literature
Synonym(s): ECK2539, G7336, b2542, hcaa4, phdA, yfhY
Genome position(nucleotides): 2672047 --> 2673249 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.03
External database links:  
ASAP:
ABE-0008363
ECHOBASE:
EB3233
OU-MICROARRAY:
b2542
PortEco:
hcaD
STRING:
511145.b2542
COLOMBOS: hcaD


Product      
Name: putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin reductase subunit
Synonym(s): 3-phenylpropionate dioxygenase, predicted ferredoxin reductase subunit, HcaD, PhdA, YfhY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.978
Isoelectric point: 5.855
Motif(s):
 
Type Positions Sequence
146 -> 174 SVVIIGAGTIGLELAASATQRRCKVTVIE
5 -> 36 TIIIVGGGQAAAMAAASLRQQGFTGELHLFSD
318 -> 400 WFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVLIGAVTLNQGREIRPIRKWIQSGKTFDAKLLIDENIALKSL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0008860 - ferredoxin-NAD+ reductase activity
GO:0008695 - 3-phenylpropionate dioxygenase activity
biological_process GO:0019439 - aromatic compound catabolic process
GO:0055114 - oxidation-reduction process
GO:0019380 - 3-phenylpropionate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
HCAD-MONOMER
ECOLIWIKI:
b2542
INTERPRO:
IPR023753
INTERPRO:
IPR036188
INTERPRO:
IPR028202
INTERPRO:
IPR023744
INTERPRO:
IPR016156
MODBASE:
P77650
PFAM:
PF14759
PFAM:
PF07992
PRIDE:
P77650
PRINTS:
PR00368
PRODB:
PRO_000022860
REFSEQ:
NP_417037
SMR:
P77650
UNIPROT:
P77650


Operon      
Name: hcaEFCBD         
Operon arrangement:
Transcription unit        Promoter
hcaEFCBD


Transcriptional Regulation      
Display Regulation             
Activated by: HcaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2835 2673321 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB