RegulonDB RegulonDB 10.8: Gene Form
   

yphB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yphC yphB yphA yphBp2 yphBp2 yphBp3 yphBp3

Gene      
Name: yphB    Texpresso search in the literature
Synonym(s): ECK2541, G7338, b2544
Genome position(nucleotides): 2673816 <-- 2674688 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.21
External database links:  
ASAP:
ABE-0008368
ECHOBASE:
EB3236
OU-MICROARRAY:
b2544
PortEco:
yphB
STRING:
511145.b2544
COLOMBOS: yphB


Product      
Name: putative aldose 1-epimerase YphB
Synonym(s): YphB, putative sulfoquinovose mutarotase YphB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 32.716
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
3 -> 285 IYTLSHGSLKLDVSDQGGVIEGFWRDTTPLLRPGKKSGVATDASCFPLVPFANRVSGNRFVWQGREYQLQPNVEWDAHYLHGDGWLGEWQCVSHSDDSLCLVYEHRSGVYHYRVSQAFHLTADTLTVTLSVTNQGAETLPFGTGWHPYFPLSPQTRIQAQASGYWLEREQWLAGEFCEQLPQELDFNQPAPLPRQWVNNGFAGWNGQARIEQPQEGYAIIMETTPPAPCYFIFVSDPAFDKGYAFDFFCLEPMSHAPDDHHRPEGGDLIALAPGESTTSEMSL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0016857 - racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0004034 - aldose 1-epimerase activity
GO:0030246 - carbohydrate binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006006 - glucose metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0033499 - galactose catabolic process via UDP-galactose
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Abayakoon P., et al., 2018
External database links:  
ECOCYC:
G7338-MONOMER
ECOLIWIKI:
b2544
INTERPRO:
IPR008183
INTERPRO:
IPR014718
INTERPRO:
IPR011013
MODBASE:
P76584
PDB:
3NRE
PFAM:
PF01263
PRIDE:
P76584
REFSEQ:
NP_417039
SMR:
P76584
UNIPROT:
P76584


Operon      
Name: yphCB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yphBp3 2674788 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yphBp2 2674795 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Abayakoon P., Lingford JP., Jin Y., Bengt C., Davies GJ., Yao S., Goddard-Borger ED., Williams SJ., 2018, Discovery and characterization of a sulfoquinovose mutarotase using kinetic analysis at equilibrium by exchange spectroscopy., Biochem J 475(7):1371-1383

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB