RegulonDB RegulonDB 10.8: Gene Form
   

yphC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yphC yphD yphB yphBp2 yphBp2 yphBp3 yphBp3

Gene      
Name: yphC    Texpresso search in the literature
Synonym(s): ECK2542, G7339, b2545
Genome position(nucleotides): 2674700 <-- 2675761 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.18
External database links:  
ASAP:
ABE-0008370
ECHOBASE:
EB3237
OU-MICROARRAY:
b2545
PortEco:
yphC
STRING:
511145.b2545
COLOMBOS: yphC


Product      
Name: putative zinc-binding dehydrogenase YphC
Synonym(s): YphC, putative oxidoreductase, Zn-dependent and NAD(P)-binding
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.051
Isoelectric point: 6.737
Motif(s):
 
Type Positions Sequence
28 -> 142 NQVLIKMKSSGICGSDVHYIYHQHRATAAAPDKPLYQGFINGHEPCGQIVAMGQGCRHFKEGDRVLVYHISGCGFCPNCRRGFPISCTGEGKAAYGWQRDGGHAEYLLAEEKDLI
185 -> 312 PVGMMAMMLAKGRGAKRIIGVDMLPERLAMAKQLGVMDHGYLATTEGLPQIIAELTHGGADVALDCSGNAAGRLLALQSTADWGRVVYIGETGKVEFEVSADLMHHQRRIIGSWVTSLFHMEKCAHDL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YPHC-MONOMER
ECOLIWIKI:
b2545
INTERPRO:
IPR002328
INTERPRO:
IPR036291
INTERPRO:
IPR020843
INTERPRO:
IPR013154
INTERPRO:
IPR013149
INTERPRO:
IPR011032
MODBASE:
P77360
PANTHER:
PTHR11695
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P77360
PROSITE:
PS00059
REFSEQ:
NP_417040
SMART:
SM00829
SMR:
P77360
UNIPROT:
P77360


Operon      
Name: yphCB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yphBp3 2674788 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yphBp2 2674795 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB