RegulonDB RegulonDB 10.8: Gene Form
   

yphE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yphE yphD yphF

Gene      
Name: yphE    Texpresso search in the literature
Synonym(s): ECK2544, G7341, b2547
Genome position(nucleotides): 2676850 <-- 2678361 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.08
External database links:  
ASAP:
ABE-0008376
ECHOBASE:
EB3239
OU-MICROARRAY:
b2547
PortEco:
yphE
STRING:
511145.b2547
COLOMBOS: yphE


Product      
Name: putative ABC transporter ATP-binding protein YphE
Synonym(s): YphE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.016
Isoelectric point: 5.423
Motif(s):
 
Type Positions Sequence
26 -> 178 LDNVNFTLNKGEVRALLGKNGAGKSTLIRMLTGSERPDSGDIWIGETRLEGDEATLTRRAAELGVRAVYQELSLVEGLTVAENLCLGQWPRRNGMIDYLQMAQDAQRCLQALGVDVSPEQLVSTLSPAQKQLVEIARVMKGEPRVVILDEPTS
170 -> 177 VVILDEPT
425 -> 432 ILLLDEPT
8 -> 249 VPVAKVVAGNKRYPGVVALDNVNFTLNKGEVRALLGKNGAGKSTLIRMLTGSERPDSGDIWIGETRLEGDEATLTRRAAELGVRAVYQELSLVEGLTVAENLCLGQWPRRNGMIDYLQMAQDAQRCLQALGVDVSPEQLVSTLSPAQKQLVEIARVMKGEPRVVILDEPTSSLASAEVELVISAVKKMSALGVAVIYVSHRMEEIRRIASCATVMRDGQVAGDVMLENTSTHHIVSLMLGRD
278 -> 432 LEDISFTLRRGEVLGIAGLLGAGRSELLKAIVGLEEYEQGEIVINGEKITRPDYGDMLKRGIGYTPENRKEAGIIPWLGVDENTVLTNRQKISANGVLQWSTIRRLTEEVMQRMTVKAASSETPIGTLSGGNQQKVVIGRWVYAASQILLLDEPT

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12830N
ECOCYC:
YPHE-MONOMER
ECOLIWIKI:
b2547
INTERPRO:
IPR027417
INTERPRO:
IPR003439
INTERPRO:
IPR003593
INTERPRO:
IPR017871
MODBASE:
P77509
PFAM:
PF00005
PRIDE:
P77509
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_417042
SMART:
SM00382
SMR:
P77509
UNIPROT:
P77509


Operon      
Name: yphFED         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB