RegulonDB RegulonDB 10.8: Gene Form
   

yphG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yphG yphH yphF anti-anti-terminator anti-terminator terminator

Gene      
Name: yphG    Texpresso search in the literature
Synonym(s): ECK2546, G7343, b2549
Genome position(nucleotides): 2679464 <-- 2682745 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.88
External database links:  
ASAP:
ABE-0008380
ECHOBASE:
EB3241
OU-MICROARRAY:
b2549
PortEco:
yphG
STRING:
511145.b2549
COLOMBOS: yphG


Product      
Name: DUF5107 domain-containing protein YphG
Synonym(s): YphG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 123.832
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
542 -> 602 ASAYERQGQYQQAEEDFWRAVWSGNSKAGGYYGLARLAARNGNFDAGLDFCQQSLRACPTN
747 -> 776 RHLLACFYYNKRSYNKAIAFWQRCVEMSPE
39 -> 343 AVYPYGVTDTLSEQKTLKSWQAVWLENDYIKVMILPELGGRVHRAWDKVKQRDFVYHNEVIKPALVGLLGPWISGGIEFNWPQHHRPTTFMPVDFTLEAHEDGAQTVWVGETEPMHGLQVMTGFTLRPDRAALEIASRVYNGNATPRHFLWWANPAVKGGEGHQSVFPPDVTAVFDHGKRAVSAFPIATGTYYKVDYSAGVDISRYKNVPVPTSYMAEKSQYDFVGAWCHDEDGGLLHVANHHIAPGKKQWSWGHSEFGQAWDKSLTDNNGPYIELMTGIFADNQPDFTWLDAYEEKRFEQYFLP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0051301 - cell division
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12832N
ECOCYC:
G7343-MONOMER
ECOLIWIKI:
b2549
INTERPRO:
IPR033396
INTERPRO:
IPR011990
INTERPRO:
IPR013026
INTERPRO:
IPR019734
MODBASE:
P76585
PFAM:
PF13181
PFAM:
PF17128
PRIDE:
P76585
PROSITE:
PS50293
REFSEQ:
NP_417044
SMART:
SM00028
SMR:
P76585
UNIPROT:
P76585


Operon      
Name: yphG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB