RegulonDB RegulonDB 10.8: Gene Form
   

glrK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glrK qseG glmY glrR glmYp2 glmYp2 glmYp1 glmYp1 glrKp glrKp TSS_2847 TSS_2847 TSS_2846 TSS_2846

Gene      
Name: glrK    Texpresso search in the literature
Synonym(s): ECK2553, G7345, b2556, qseE, yfhK, yfhZ
Genome position(nucleotides): 2689671 <-- 2691098 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.15
External database links:  
ASAP:
ABE-0008409
ECHOBASE:
EB3234
OU-MICROARRAY:
b2556
PortEco:
glrK
STRING:
511145.b2556
COLOMBOS: glrK


Product      
Name: histidine kinase GlrK
Synonym(s): GlrK, QseE, YfhK, YfhZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space,cytosol
Molecular weight: 53.33
Isoelectric point: 7.878
Motif(s):
 
Type Positions Sequence
256 -> 472 HLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSAVELENVELAPLVETVVSAHSLPARAKMMHTDVDLKATACLAEPMLLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDESGQDVCFRIELPSSK
364 -> 470 LLMSVLDNLYSNAVHYGAESGNICLRSSLHGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQGELYLVDESGQDVCFRIELPS
58 -> 58 S
250 -> 316 RHQFLRHLSHELKTPLASMREGTELLADQVVGPLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQA
14 -> 34 LVMLAFLLILLPLLVLAWQAW

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0016774 - phosphotransferase activity, carboxyl group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0000156 - phosphorelay response regulator activity
GO:0030295 - protein kinase activator activity
biological_process GO:0071871 - response to epinephrine
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0007234 - osmosensory signaling via phosphorelay pathway
GO:0046777 - protein autophosphorylation
GO:0032147 - activation of protein kinase activity
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
DIP:
DIP-12052N
ECOCYC:
G7345-MONOMER
ECOLIWIKI:
b2556
INTERPRO:
IPR005467
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003594
MODBASE:
P52101
PFAM:
PF00512
PFAM:
PF02518
PRIDE:
P52101
PRINTS:
PR00344
PRODB:
PRO_000025101
PROSITE:
PS50109
REFSEQ:
NP_417051
SMART:
SM00387
SMART:
SM00388
SMR:
P52101
UNIPROT:
P52101


Operon      
Name: glrK         
Operon arrangement:
Transcription unit        Promoter
glrK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2846 2690181 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2847 2690186 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB