RegulonDB RegulonDB 10.8: Gene Form
   

ygcP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcQ ygcP ygcO ygcN ygcR

Gene      
Name: ygcP    Texpresso search in the literature
Synonym(s): ECK2763, G7434, b2768
Genome position(nucleotides): 2894196 --> 2894771 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.53
External database links:  
ASAP:
ABE-0009074
ECHOBASE:
EB2924
OU-MICROARRAY:
b2768
PortEco:
ygcP
STRING:
511145.b2768
COLOMBOS: ygcP


Product      
Name: putative anti-terminator regulatory protein
Synonym(s): YgcP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.786
Isoelectric point: 7.819
Motif(s):
 
Type Positions Sequence
12 -> 184 VIAAVKDNASLQLAIDSECQFISVLYGNICTISNIVKKIKNAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTNTGVW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0006071 - glycerol metabolic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12132N
ECOCYC:
G7434-MONOMER
ECOLIWIKI:
b2768
INTERPRO:
IPR006699
INTERPRO:
IPR035928
MINT:
MINT-1221014
MODBASE:
Q46906
PANTHER:
PTHR35787
PFAM:
PF04309
PRIDE:
Q46906
REFSEQ:
NP_417248
SMR:
Q46906
UNIPROT:
Q46906


Operon      
Name: ygcNOP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB