RegulonDB RegulonDB 10.8: Gene Form
   

yqgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speA yqgG yqgB yqgC PurR terminator yqgBp1 yqgBp1 yqgBp4 yqgBp4 speAp speAp TSS_3265 TSS_3265 TSS_3264 TSS_3264 TSS_3263 TSS_3263 speBp speBp

Gene      
Name: yqgB    Texpresso search in the literature
Synonym(s): ECK2934, G7521, b2939
Genome position(nucleotides): 3085920 <-- 3086051 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.91
External database links:  
ASAP:
ABE-0009638
ECHOBASE:
EB2956
OU-MICROARRAY:
b2939
PortEco:
yqgB
STRING:
511145.b2939
COLOMBOS: yqgB


Product      
Name: acid stress response protein YqgB
Synonym(s): YqgB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 4.859
Isoelectric point: 9.428
Motif(s):
 
Type Positions Sequence
1 -> 43 MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
biological_process GO:0010447 - response to acidic pH
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hobbs EC., et al., 2010
External database links:  
ECOCYC:
G7521-MONOMER
ECOLIWIKI:
b2939
INTERPRO:
IPR020196
PFAM:
PF11036
PRIDE:
P64567
PRODOM:
PD050163
REFSEQ:
NP_417414
UNIPROT:
P64567


Operon      
Name: yqgB         
Operon arrangement:
Transcription unit        Promoter
yqgB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3263 3084201 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3264 3084894 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3265 3085378 reverse nd [RS-EPT-CBR] [2]
  promoter yqgBp4 3086182 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yqgBp1 3086250 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hobbs EC., Astarita JL., Storz G., 2010, Small RNAs and small proteins involved in resistance to cell envelope stress and acid shock in Escherichia coli: analysis of a bar-coded mutant collection., J Bacteriol 192(1):59-67

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB