RegulonDB RegulonDB 10.8: Gene Form
   

yqgC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metK yqgD yqgC yqgG yqgB MetJ MetJ CRP PurR terminator TSS_3268 TSS_3268 TSS_3267 (cluster) TSS_3267 (cluster) TSS_3266 TSS_3266 metKp metKp yqgBp1 yqgBp1 yqgBp4 yqgBp4 speAp speAp

Gene      
Name: yqgC    Texpresso search in the literature
Synonym(s): ECK2935, G7522, b2940
Genome position(nucleotides): 3086187 --> 3086402 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0009643
ECHOBASE:
EB2957
OU-MICROARRAY:
b2940
PortEco:
yqgC
STRING:
511145.b2940
COLOMBOS: yqgC


Product      
Name: protein YqgC
Synonym(s): YqgC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.114
Isoelectric point: 12.032
Motif(s):
 
Type Positions Sequence
1 -> 51 MGITSAGMQSRDAECGERIFTRTVRQVKQQTTVHYFVSPPRPPVKTNPQAK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7522-MONOMER
ECOLIWIKI:
b2940
INTERPRO:
IPR020102
PFAM:
PF17430
PRIDE:
P64570
PRODOM:
PD056256
REFSEQ:
NP_417415
UNIPROT:
P64570


Operon      
Name: yqgC         
Operon arrangement:
Transcription unit        Promoter
yqgC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqgBp4 3086182 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqgBp1 3086250 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3266 3086683 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3267 (cluster) 3087216 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3268 3087246 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB