RegulonDB RegulonDB 10.8: Gene Form
   

yqgD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metK yqgD yqgC yqgG MetJ MetJ CRP TSS_3268 TSS_3268 TSS_3267 (cluster) TSS_3267 (cluster) TSS_3266 TSS_3266 metKp metKp yqgBp1 yqgBp1 yqgBp4 yqgBp4

Gene      
Name: yqgD    Texpresso search in the literature
Synonym(s): ECK2936, G7523, b2941
Genome position(nucleotides): 3086399 <-- 3086650 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.86
External database links:  
ASAP:
ABE-0009645
ECHOBASE:
EB2958
OU-MICROARRAY:
b2941
PortEco:
yqgD
COLOMBOS: yqgD


Product      
Name: DUF2684 domain-containing protein YqgD
Synonym(s): YqgD
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.519
Isoelectric point: 9.721
Motif(s):
 
Type Positions Sequence
1 -> 79 MVADPTTTLQVKNTGSLSVNRYGWINIWMAILGQFFTLFPLFFESCLILLKTWLEIFPDNAGILRIYLLQFSAIVGYKT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7523-MONOMER
ECOLIWIKI:
b2941
INTERPRO:
IPR020263
PFAM:
PF10885
PRIDE:
P46879
PRODOM:
PD060540
REFSEQ:
NP_417416
UNIPROT:
P46879


Operon      
Name: yqgD         
Operon arrangement:
Transcription unit        Promoter
yqgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqgBp4 3086182 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqgBp1 3086250 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3266 3086683 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3267 (cluster) 3087216 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3268 3087246 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB