RegulonDB RegulonDB 10.10: Gene Form
   

mltC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nupG mltC yggX CRP CRP CRP CytR CytR CytR CRP terminator anti-terminator anti-anti-terminator nupGp nupGp

Gene      
Name: mltC    Texpresso search in the literature
Synonym(s): ECK2958, G7533, b2963, yggZ
Genome position(nucleotides): 3104433 --> 3105512 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.11
External database links:  
ASAP:
ABE-0009725
ECHOBASE:
EB2810
ECOLIHUB:
mltC
OU-MICROARRAY:
b2963
STRING:
511145.b2963
COLOMBOS: mltC


Product      
Name: membrane-bound lytic murein transglycosylase C
Synonym(s): MltC, YggZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,outer membrane
Molecular weight: 40.113
Isoelectric point: 9.692
Motif(s):
 
Type Positions Sequence
1 -> 16 MKKYLALALIAPLLIS
17 -> 359 CSTTKKGDTYNEAWVKDTNGFDILMGQFAHNIENIWGFKEVVIAGPKDYVKYTDQYQTRSHINFDDGTITIETIAGTEPAAHLRRAIIKTLLMGDDPSSVDLYSDVDDITISKEPFLYGQVVDNTGQPIRWEGRASNFADYLLKNRLKSRSNGLRIIYSVTINMVPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTESSFNPYAVSRSDALGLMQVVQHTAGKDVFRSQGKSGTPSRSFLFDPASNIDTGTAYLAMLNNVYLGGIDNPTSRRYAVITAYNGGAGSVLRVFSNDKIQAANIINTMTPGDVYQTLTTRHPSAESRRYLYKVNTAQKSYRRR
31 -> 191 VKDTNGFDILMGQFAHNIENIWGFKEVVIAGPKDYVKYTDQYQTRSHINFDDGTITIETIAGTEPAAHLRRAIIKTLLMGDDPSSVDLYSDVDDITISKEPFLYGQVVDNTGQPIRWEGRASNFADYLLKNRLKSRSNGLRIIYSVTINMVPNHLDKRAHK
196 -> 319 VRQASRKYGVDESLILAIMQTESSFNPYAVSRSDALGLMQVVQHTAGKDVFRSQGKSGTPSRSFLFDPASNIDTGTAYLAMLNNVYLGGIDNPTSRRYAVITAYNGGAGSVLRVFSNDKIQAAN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0031225 - anchored component of membrane
molecular_function GO:0016829 - lyase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0008933 - lytic transglycosylase activity
GO:0008932 - lytic endotransglycosylase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0051301 - cell division
GO:0009253 - peptidoglycan catabolic process
GO:0016998 - cell wall macromolecule catabolic process
GO:0034599 - cellular response to oxidative stress
GO:0071555 - cell wall organization
GO:0071236 - cellular response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Blackburn NT., et al., 2001
[2] Rao S., et al., 2020
External database links:  
CAZY:
GH23
ECOCYC:
G7533-MONOMER
ECOLIWIKI:
b2963
INTERPRO:
IPR024570
INTERPRO:
IPR023664
INTERPRO:
IPR000189
INTERPRO:
IPR008258
INTERPRO:
IPR023346
MODBASE:
P0C066
PDB:
4CHX
PDB:
4CFP
PDB:
4CFO
PDB:
4C5F
PFAM:
PF01464
PFAM:
PF11873
PRIDE:
P0C066
PRODB:
PRO_000023247
PROSITE:
PS00922
PROSITE:
PS51257
REFSEQ:
NP_417438
SMR:
P0C066
UNIPROT:
P0C066


Operon      
Name: mutY-yggX-mltC-nupG         
Operon arrangement:
Transcription unit        Promoter
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
yggX
yggX-mltC
yggX-mltC-nupG
nupG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Blackburn NT., Clarke AJ., 2001, Identification of four families of peptidoglycan lytic transglycosylases., J Mol Evol 52(1):78-84

 [2] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3


RegulonDB