RegulonDB RegulonDB 10.9: Gene Form
   

glcG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glcB glcF glcG TSS_3300 TSS_3300

Gene      
Name: glcG    Texpresso search in the literature
Synonym(s): ECK2971, G7543, b2977, yghC
Genome position(nucleotides): 3123827 <-- 3124231 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.57
External database links:  
ASAP:
ABE-0009769
ECHOBASE:
EB2786
ECOLIHUB:
glcG
OU-MICROARRAY:
b2977
STRING:
511145.b2977
COLOMBOS: glcG


Shine dalgarno      
Sequence: gcccttgaaaAGGAATaacaaAAT


Product      
Name: putative heme-binding protein GlcG
Synonym(s): GlcG, YghC, conserved protein GlcG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.737
Isoelectric point: 5.855
Motif(s):
 
Type Positions Sequence
128 -> 134 AAAVLAK
7 -> 129 LSQQMASAIIAAGQEEAQKNNWSVSIAVADDGGHLLALSRMDDCAPIAAYISQEKARTAALGRRETKGYEEMVNNGRTAFVTAPLLTSLEGGVPVVVDGQIIGAVGVSGLTGAQDAQVAKAAA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Choi SY., et al., 2016
External database links:  
DIP:
DIP-9766N
ECOCYC:
G7543-MONOMER
ECOLIWIKI:
b2977
INTERPRO:
IPR005624
INTERPRO:
IPR038084
MODBASE:
P0AEQ1
PFAM:
PF03928
PRIDE:
P0AEQ1
REFSEQ:
NP_417451
SMR:
P0AEQ1
UNIPROT:
P0AEQ1


Operon      
Name: glcDEFGBA         
Operon arrangement:
Transcription unit        Promoter
glcDEFGBA
glcBA


Transcriptional Regulation      
Display Regulation             
Activated by: GlcC, IHF
Repressed by: ArcA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3300 3124265 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Choi SY., Park SJ., Kim WJ., Yang JE., Lee H., Shin J., Lee SY., 2016, One-step fermentative production of poly(lactate-co-glycolate) from carbohydrates in Escherichia coli., Nat Biotechnol 34(4):435-40

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB