RegulonDB RegulonDB 10.9: Gene Form
   

glcE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glcD glcF glcE glcC Fis GlcC Cra ArcA CRP IHF ArcA Fis PdhR Fis Fis glcCp glcCp glcDp glcDp TSS_3300 TSS_3300

Gene      
Name: glcE    Texpresso search in the literature
Synonym(s): ECK2973, G7544, b2978, b4468, gox, yghL
Genome position(nucleotides): 3125470 <-- 3126522 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.55
Reference(s): [1] Pellicer MT., et al., 1996
External database links:  
ASAP:
ABE-0174098
ECHOBASE:
EB2819
ECOLIHUB:
glcE
OU-MICROARRAY:
b2978
STRING:
511145.b4468
COLOMBOS: glcE


Shine dalgarno      
Sequence: ttccctgaacTGGAGCgtttctGAT


Product      
Name: glycolate dehydrogenase, putative FAD-binding subunit
Synonym(s): GlcE, Gox, YghL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 38.361
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
1 -> 173 MLRECDYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTELVITARVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDFVLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVLPR
12 -> 136 LEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTELVITARVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDFVLGTRIITGAGKHLRF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.25 - glycolate metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0019154 - glycolate dehydrogenase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0004458 - D-lactate dehydrogenase (cytochrome) activity
GO:0008720 - D-lactate dehydrogenase activity
GO:0071949 - FAD binding
biological_process GO:0046296 - glycolate catabolic process
GO:0055114 - oxidation-reduction process
GO:1903457 - lactate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [2] Choi SY., et al., 2016
External database links:  
ECOCYC:
G7544-MONOMER
ECOLIWIKI:
b4468
INTERPRO:
IPR016164
INTERPRO:
IPR036318
INTERPRO:
IPR016169
INTERPRO:
IPR016166
INTERPRO:
IPR006094
MODBASE:
P52073
PFAM:
PF01565
PRIDE:
P52073
PROSITE:
PS51387
REFSEQ:
YP_026191
SMR:
P52073
UNIPROT:
P52073


Operon      
Name: glcDEFGBA         
Operon arrangement:
Transcription unit        Promoter
glcDEFGBA
glcBA


Transcriptional Regulation      
Display Regulation             
Activated by: GlcC, IHF
Repressed by: ArcA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3300 3124265 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pellicer MT., Badia J., Aguilar J., Baldoma L., 1996, glc locus of Escherichia coli: characterization of genes encoding the subunits of glycolate oxidase and the glc regulator protein., J Bacteriol 178(7):2051-9

 [2] Choi SY., Park SJ., Kim WJ., Yang JE., Lee H., Shin J., Lee SY., 2016, One-step fermentative production of poly(lactate-co-glycolate) from carbohydrates in Escherichia coli., Nat Biotechnol 34(4):435-40

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB