RegulonDB RegulonDB 10.9: Gene Form
   

glcC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glcD yghO glcC insH9 Fis GlcC Cra ArcA CRP IHF ArcA Fis PdhR Fis Fis TSS_3302 TSS_3302 TSS_3301 TSS_3301 insHp4 insHp4 glcCp glcCp glcDp glcDp

Gene      
Name: glcC    Texpresso search in the literature
Synonym(s): ECK2975, G7546, b2980, yghN
Genome position(nucleotides): 3128272 --> 3129036 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.03
External database links:  
ASAP:
ABE-0009777
ECHOBASE:
EB2821
ECOLIHUB:
glcC
OU-MICROARRAY:
b2980
STRING:
511145.b2980
COLOMBOS: glcC


Shine dalgarno      
Sequence: acctgtgcacGAGGTCcgggaATG


Product      
Name: DNA-binding transcriptional dual regulator GlcC
Synonym(s): GlcC, YghN
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 28.826
Isoelectric point: 9.268
Motif(s):
 
Type Positions Sequence
11 -> 69 VVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDS
96 -> 226 DLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVR
6 -> 74 RPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARL
34 -> 53 ERRLCEKLGFSRSALREGLT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7546-MONOMER
ECOLIWIKI:
b2980
INTERPRO:
IPR008920
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR011711
INTERPRO:
IPR000524
MODBASE:
P0ACL5
PFAM:
PF07729
PFAM:
PF00392
PRIDE:
P0ACL5
PRINTS:
PR00035
PRODB:
PRO_000022773
PROSITE:
PS50949
REFSEQ:
NP_417454
SMART:
SM00345
SMART:
SM00895
SMR:
P0ACL5
UNIPROT:
P0ACL5


Operon      
Name: glcC         
Operon arrangement:
Transcription unit        Promoter
glcC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GlcC, Cra, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insHp4 3130025 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3301 3130141 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3302 3130187 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB