RegulonDB RegulonDB 10.10: Gene Form
   

insH9 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yghO yghQ insH9 glcC Fis terminator TSS_3303 TSS_3303 TSS_3302 TSS_3302 TSS_3301 TSS_3301 insHp4 insHp4

Gene      
Name: insH9    Texpresso search in the literature
Synonym(s): ECK0261, G7548, b2982, trs5-9, yi52_9
Genome position(nucleotides): 3130214 --> 3131194 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
External database links:  
ASAP:
ABE-0009783
ECOLIHUB:
insH-9
OU-MICROARRAY:
b2982
STRING:
511145.b3505
COLOMBOS: insH9


Product      
Name: IS5 transposase and trans-activator
Synonym(s): InsH9
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.851
Isoelectric point: 10.028
Motif(s):
 
Type Positions Sequence
51 -> 124 GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
138 -> 312 QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4239
ECOLIWIKI:
b2982
INTERPRO:
IPR008490
INTERPRO:
IPR002559
PFAM:
PF01609
PFAM:
PF05598
PRIDE:
P0CE56
REFSEQ:
NP_417456
UNIPROT:
P0CE56


Operon      
Name: insH9         
Operon arrangement:
Transcription unit        Promoter
insH-9


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insHp4 3130025 forward nd [ICWHO] [1]
  promoter TSS_3301 3130141 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3302 3130187 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3303 3131165 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB