RegulonDB RegulonDB 10.9: Gene Form
   

yqhD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yqhD yqhC dkgA YqhC YqhC anti-anti-terminator anti-terminator terminator terminator TSS_3319 TSS_3319 dkgAp dkgAp yqhCp1 yqhCp1 TSS_3318 TSS_3318 yqhDp yqhDp

Gene      
Name: yqhD    Texpresso search in the literature
Synonym(s): ECK3003, G7564, b3011
Genome position(nucleotides): 3155355 --> 3156518 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0009888
ECHOBASE:
EB2834
ECOLIHUB:
yqhD
OU-MICROARRAY:
b3011
STRING:
511145.b3011
COLOMBOS: yqhD


Product      
Name: NADPH-dependent aldehyde reductase YqhD
Synonym(s): YqhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.097
Isoelectric point: 6.046
Motif(s):
 
Type Positions Sequence
179 -> 182 YTYT
38 -> 40 GGS
93 -> 99 GGGSVLD
9 -> 360 PTRILFGKGAIAGLREQIPHDARVLITYGGGSVKKTGVLDQVLDALKGMDVLEFGGIEPNPAYETLMNAVKLVREQKVTFLLAVGGGSVLDGTKFIAAAANYPENIDPWHILQTGGKEIKSAIPMGCVLTLPATGSESNAGAVISRKTTGDKQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTKPVDAKIQDRFAEGILLTLIEDGPKALKEPENYDVRANVMWAATQALNGLIGAGVPQDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAKLLQYAERVWNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSSIPALLKKL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
GO:0008106 - alcohol dehydrogenase (NADP+) activity
GO:1990002 - methylglyoxal reductase (NADPH-dependent, acetol producing)
GO:0018455 - alcohol dehydrogenase [NAD(P)+] activity
biological_process GO:0000302 - response to reactive oxygen species
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Geddes RD., et al., 2014
[2] Lee C., et al., 2016
[3] Lee C., et al., 2012
[4] McCloskey D., et al., 2018
[5] Seo HM., et al., 2016
[6] Song X., et al., 2016
[7] Tokuyama K., et al., 2014
[8] Tsuruno K., et al., 2015
External database links:  
DIP:
DIP-12870N
ECOCYC:
G7564-MONOMER
ECOLIWIKI:
b3011
INTERPRO:
IPR018211
INTERPRO:
IPR001670
MODBASE:
Q46856
PDB:
4QGS
PDB:
1OJ7
PFAM:
PF00465
PRIDE:
Q46856
PROSITE:
PS00913
PROSITE:
PS00060
REFSEQ:
NP_417484
SMR:
Q46856
SWISSMODEL:
Q46856
UNIPROT:
Q46856


Operon      
Name: yqhD-dkgA         
Operon arrangement:
Transcription unit        Promoter
yqhD-dkgA
 


Transcriptional Regulation      
Display Regulation             
Activated by: YqhC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3318 3155303 forward nd [RS-EPT-CBR] [9]
  promoter yqhCp1 3155384 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter TSS_3319 3156572 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Geddes RD., Wang X., Yomano LP., Miller EN., Zheng H., Shanmugam KT., Ingram LO., 2014, Polyamine transporters and polyamines increase furfural tolerance during xylose fermentation with ethanologenic Escherichia coli strain LY180., Appl Environ Microbiol 80(19):5955-64

 [2] Lee C., Kwon M., Lee K., Min H., Kim SH., Lee N., Kim J., Kim D., Ko C., Park C., 2016, Screening for Escherichia coli K-12 genes conferring glyoxal resistance or sensitivity by transposon insertions., FEMS Microbiol Lett 363(18)

 [3] Lee C., Park C., 2012, Development of a suicidal vector-cloning system based on butanal susceptibility due to an expression of YqhD aldehyde reductase., J Microbiol 50(2):249-55

 [4] McCloskey D., Xu S., Sandberg TE., Brunk E., Hefner Y., Szubin R., Feist AM., Palsson BO., 2018, Adaptation to the coupling of glycolysis to toxic methylglyoxal production in tpiA deletion strains of Escherichia coli requires synchronized and counterintuitive genetic changes., Metab Eng 48:82-93

 [5] Seo HM., Jeon JM., Lee JH., Song HS., Joo HB., Park SH., Choi KY., Kim YH., Park K., Ahn J., Lee H., Yang YH., 2016, Combinatorial application of two aldehyde oxidoreductases on isobutanol production in the presence of furfural., J Ind Microbiol Biotechnol 43(1):37-44

 [6] Song X., Yu H., Zhu K., 2016, Improving alkane synthesis in Escherichia coli via metabolic engineering., Appl Microbiol Biotechnol 100(2):757-67

 [7] Tokuyama K., Ohno S., Yoshikawa K., Hirasawa T., Tanaka S., Furusawa C., Shimizu H., 2014, Increased 3-hydroxypropionic acid production from glycerol, by modification of central metabolism in Escherichia coli., Microb Cell Fact 13:64

 [8] Tsuruno K., Honjo H., Hanai T., 2015, Enhancement of 3-hydroxypropionic acid production from glycerol by using a metabolic toggle switch., Microb Cell Fact 14:155

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB