RegulonDB RegulonDB 10.10: Gene Form
   

ygjH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

patA ebgR ygjH ebgRp ebgRp ygjHp4 ygjHp4 ygjHp3 ygjHp3

Gene      
Name: ygjH    Texpresso search in the literature
Synonym(s): ECK3064, G7597, b3074
Genome position(nucleotides): 3220915 <-- 3221247 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.55
External database links:  
ASAP:
ABE-0010094
ECHOBASE:
EB2578
ECOLIHUB:
ygjH
MIM:
608323
OU-MICROARRAY:
b3074
STRING:
511145.b3074
COLOMBOS: ygjH


Product      
Name: putative tRNA-binding protein YgjH
Synonym(s): YgjH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.315
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
8 -> 110 DFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVV
14 -> 107 MRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0042803 - protein homodimerization activity
External database links:  
DIP:
DIP-12234N
ECOCYC:
G7597-MONOMER
ECOLIWIKI:
b3074
INTERPRO:
IPR012340
INTERPRO:
IPR002547
MODBASE:
P42589
PDB:
3ERS
PFAM:
PF01588
PRIDE:
P42589
PROSITE:
PS50886
REFSEQ:
NP_417545
SMR:
P42589
UNIPROT:
P42589


Operon      
Name: ygjH         
Operon arrangement:
Transcription unit        Promoter
ygjH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygjHp3 3221255 reverse nd [ICWHO] [1]
  promoter ygjHp4 3221264 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB