RegulonDB RegulonDB 10.9: Gene Form
   

yhhW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhhX gntR yhhW terminator TSS_4053 TSS_4053 gntRp4 gntRp4 gntRp3 gntRp3 gntRp2 gntRp2 gntRp1 gntRp1

Gene      
Name: yhhW    Texpresso search in the literature
Synonym(s): ECK3424, G7756, b3439
Genome position(nucleotides): 3578950 <-- 3579645 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.3
External database links:  
ASAP:
ABE-0011228
ECHOBASE:
EB2777
ECOLIHUB:
yhhW
OU-MICROARRAY:
b3439
STRING:
511145.b3439
COLOMBOS: yhhW


Product      
Name: quercetin 2,3-dioxygenase
Synonym(s): YhhW, pirin-like protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.279
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
143 -> 228 LVLSPDARDGSLKVHQDMELYRWALLKDEQSVHQIAAERRVWIQVVKGNVTINGVKASTSDGLAIWDEQAISIHADSDSEVLLFDL
7 -> 119 ANERGHANHGWLDSWHTFSFANYYDPNFMGFSALRVINDDVIEAGQGFGTHPHKDMEILTYVLEGTVEHQDSMGNKEQVPAGEFQIMSAGTGIRHSEYNPSSTERLHLYQIWI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008127 - quercetin 2,3-dioxygenase activity
GO:0051213 - dioxygenase activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Adams MA., et al., 2007
External database links:  
DIP:
DIP-12356N
ECOCYC:
G7756-MONOMER
ECOLIWIKI:
b3439
INTERPRO:
IPR003829
INTERPRO:
IPR041602
INTERPRO:
IPR014710
INTERPRO:
IPR011051
INTERPRO:
IPR012093
MODBASE:
P46852
PDB:
1TQ5
PDB:
6UTS
PFAM:
PF17954
PFAM:
PF02678
PRIDE:
P46852
REFSEQ:
NP_417896
SMR:
P46852
UNIPROT:
P46852


Operon      
Name: yhhW         
Operon arrangement:
Transcription unit        Promoter
yhhW


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gntRp1 3578749 reverse The gntRp promoter is constitutively
Read more >
[AIPP], [ICWHO] [2], [3]
  promoter TSS_4053 3579673 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adams MA., Suits MD., Zheng J., Jia Z., 2007, Piecing together the structure-function puzzle: experiences in structure-based functional annotation of hypothetical proteins., Proteomics 7(16):2920-32

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Izu H., Adachi O., Yamada M., 1997, Gene organization and transcriptional regulation of the gntRKU operon involved in gluconate uptake and catabolism of Escherichia coli., J Mol Biol 267(4):778-93

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB