RegulonDB RegulonDB 10.10: Gene Form
   

rsgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsgA psd orn CpxR terminator TSS_5008 TSS_5008 TSS_5007 TSS_5007 ornp5 ornp5 TSS_5006 TSS_5006 TSS_5005 TSS_5005 rsgAp12 rsgAp12 TSS_5004 TSS_5004 TSS_5003 (cluster) TSS_5003 (cluster) TSS_5002 TSS_5002 psdp psdp TSS_5001 TSS_5001

Gene      
Name: rsgA    Texpresso search in the literature
Synonym(s): ECK4157, G7841, b4161, yjeQ
Genome position(nucleotides): 4390457 <-- 4391509 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.94
External database links:  
ASAP:
ABE-0013626
ECHOBASE:
EB2372
ECOLIHUB:
rsgA
OU-MICROARRAY:
b4161
STRING:
511145.b4161
COLOMBOS: rsgA


Product      
Name: ribosome small subunit-dependent GTPase A
Synonym(s): RsgA, YjeQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.193
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
160 -> 163 NKID
221 -> 221 S
287 -> 319 FVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEG
320 -> 350 KIAETRFENYHRILESMAQVKTRKNFSDTDD
214 -> 222 GQSGVGKSS

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0019843 - rRNA binding
GO:0005525 - GTP binding
GO:0019003 - GDP binding
GO:0043024 - ribosomal small subunit binding
GO:0097216 - guanosine tetraphosphate binding
biological_process GO:0042254 - ribosome biogenesis
GO:0042274 - ribosomal small subunit biogenesis
GO:0000028 - ribosomal small subunit assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Hase Y., et al., 2009
[2] Sharma H., et al., 2016
[3] Tarusawa T., et al., 2016
[4] Yang Z., et al., 2014
[5] Zhang Y., et al., 2018
External database links:  
DIP:
DIP-12581N
ECOCYC:
G7841-MONOMER
ECOLIWIKI:
b4161
INTERPRO:
IPR004881
INTERPRO:
IPR010914
INTERPRO:
IPR027417
INTERPRO:
IPR030378
MINT:
P39286
PANTHER:
PTHR32120
PDB:
2YKR
PDB:
5UZ4
PDB:
5NO4
PDB:
5NO3
PDB:
5NO2
PDB:
4A2I
PFAM:
PF03193
PRIDE:
P39286
PROSITE:
PS51721
PROSITE:
PS50936
REFSEQ:
NP_418585
SMR:
P39286
SWISSMODEL:
P39286
UNIPROT:
P39286


Operon      
Name: rsgA         
Operon arrangement:
Transcription unit        Promoter
rsgA


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5001 4389996 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_5002 4390663 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_5003 (cluster) 4391547 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_5004 4391561 forward nd [RS-EPT-CBR] [6]
  promoter rsgAp12 4391566 reverse nd [ICWHO] [7]
  promoter TSS_5005 4391570 forward nd [RS-EPT-CBR] [6]
  promoter TSS_5006 4391574 forward nd [RS-EPT-CBR] [6]
  promoter ornp5 4391584 forward nd [ICWHO] [7]
  promoter TSS_5007 4391589 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_5008 4391716 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hase Y., Yokoyama S., Kimura T., Goto S., Muto A., Himeno H., 2009, Physiological role of RsgA in ribosome biosynthesis., Nucleic Acids Symp Ser (Oxf) (53):307-8

 [2] Sharma H., Anand B., 2016, Fluorescence bimolecular complementation enables facile detection of ribosome assembly defects in Escherichia coli., RNA Biol 13(9):872-82

 [3] Tarusawa T., Ito S., Goto S., Ushida C., Muto A., Himeno H., 2016, (p)ppGpp-dependent and -independent pathways for salt tolerance in Escherichia coli., J Biochem 160(1):19-26

 [4] Yang Z., Guo Q., Goto S., Chen Y., Li N., Yan K., Zhang Y., Muto A., Deng H., Himeno H., Lei J., Gao N., 2014, Structural insights into the assembly of the 30S ribosomal subunit in vivo: functional role of S5 and location of the 17S rRNA precursor sequence., Protein Cell 5(5):394-407

 [5] Zhang Y., Zbornikova E., Rejman D., Gerdes K., 2018, Novel (p)ppGpp Binding and Metabolizing Proteins of Escherichia coli., MBio 9(2)

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB