RegulonDB RegulonDB 10.9: Gene Form
   

bsmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjfP bsmA yjfN ulaR terminator TSS_5054 TSS_5054 yjfPp5 yjfPp5 bsmAp bsmAp yjfPp4 yjfPp4

Gene      
Name: bsmA    Texpresso search in the literature
Synonym(s): ECK4185, G7852, b4189, yjfO
Genome position(nucleotides): 4416441 <-- 4416770 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.79
External database links:  
ASAP:
ABE-0013706
ECHOBASE:
EB2382
ECOLIHUB:
bsmA
OU-MICROARRAY:
b4189
STRING:
511145.b4189
COLOMBOS: bsmA


Product      
Name: DUF1471 domain-containing putative lipoprotein BsmA
Synonym(s): BsmA, YjfO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 12.038
Isoelectric point: 9.794
Motif(s):
 
Type Positions Sequence
1 -> 24 MVSRKRNSVIYRFASLLLVLMLSA
53 -> 108 LQRIGSVSTMVRGSPDDALAEIKAKAVAAKADYYVVVMVDETIVTGQWYSQAILYR
25 -> 109 CSALQGTPQPAPPVTDHPQEIRRDQTQGLQRIGSVSTMVRGSPDDALAEIKAKAVAAKADYYVVVMVDETIVTGQWYSQAILYRK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Weber MM., et al., 2010
External database links:  
ECOCYC:
G7852-MONOMER
ECOLIWIKI:
b4189
INTERPRO:
IPR010854
INTERPRO:
IPR036275
INTERPRO:
IPR025543
PFAM:
PF07338
PRIDE:
P39297
PROSITE:
PS51257
REFSEQ:
NP_418610
UNIPROT:
P39297


Operon      
Name: bsmA         
Operon arrangement:
Transcription unit        Promoter
bsmA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjfPp4 4416756 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjfPp5 4416935 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_5054 4416936 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Weber MM., French CL., Barnes MB., Siegele DA., McLean RJ., 2010, A previously uncharacterized gene, yjfO (bsmA), influences Escherichia coli biofilm formation and stress response., Microbiology 156(Pt 1):139-47

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB