RegulonDB RegulonDB 10.9: Gene Form
   

yjfP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaG ulaR yjfP bsmA ulaRp5 ulaRp5 TSS_5054 TSS_5054 yjfPp5 yjfPp5 bsmAp bsmAp yjfPp4 yjfPp4

Gene      
Name: yjfP    Texpresso search in the literature
Synonym(s): ECK4186, G7853, b4190
Genome position(nucleotides): 4416952 --> 4417701 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.2
External database links:  
ASAP:
ABE-0013711
ECHOBASE:
EB2383
ECOLIHUB:
yjfP
OU-MICROARRAY:
b4190
STRING:
511145.b4190
COLOMBOS: yjfP


Product      
Name: carboxylesterase
Synonym(s): YjfP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.588
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
86 -> 234 QSMQEFTTLRAAIAEENWLLDDRLAVGGASMGAMTALGITARHPTVRCTASMMGSGYFTSLARSLFPPLIPETAAQQNEFNNIVAPLAEWEATNHLEQLSDRPLLLWHGLDDDVVPADESLRLQQALSETGRDKLLTCSWQPGVRHRIT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0008236 - serine-type peptidase activity
GO:0042803 - protein homodimerization activity
GO:0034338 - short-chain carboxylesterase activity
biological_process GO:0006508 - proteolysis
External database links:  
ECOCYC:
G7853-MONOMER
ECOLIWIKI:
b4190
INTERPRO:
IPR001375
INTERPRO:
IPR029058
MODBASE:
P39298
PFAM:
PF00326
PRIDE:
P39298
REFSEQ:
NP_418611
SMR:
P39298
UNIPROT:
P39298


Operon      
Name: yjfP         
Operon arrangement:
Transcription unit        Promoter
yjfP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjfPp4 4416756 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yjfPp5 4416935 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5054 4416936 forward nd [RS-EPT-CBR] [2]
  promoter ulaRp5 4418562 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB