RegulonDB RegulonDB 10.9: Gene Form
   

ulaG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ulaA ulaG ulaR yjfP UlaR UlaR CRP UlaR UlaR ulaAp ulaAp ulaGp ulaGp ulaRp5 ulaRp5

Gene      
Name: ulaG    Texpresso search in the literature
Synonym(s): ECK4188, G7855, b4192, yjfR
Genome position(nucleotides): 4418561 <-- 4419625 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.21
Reference(s): [1] Campos E., et al., 2002
External database links:  
ASAP:
ABE-0013717
ECHOBASE:
EB2385
ECOLIHUB:
ulaG
OU-MICROARRAY:
b4192
STRING:
511145.b4192
COLOMBOS: ulaG


Product      
Name: L-ascorbate-6-phosphate lactonase
Synonym(s): UlaG, YjfR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.061
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
42 -> 281 WLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0016787 - hydrolase activity
GO:0030145 - manganese ion binding
GO:0035460 - L-ascorbate 6-phosphate lactonase activity
GO:0052689 - carboxylic ester hydrolase activity
biological_process GO:0019854 - L-ascorbic acid catabolic process
External database links:  
DIP:
DIP-12596N
ECOCYC:
G7855-MONOMER
ECOLIWIKI:
b4192
INTERPRO:
IPR036866
INTERPRO:
IPR023951
MODBASE:
P39300
PDB:
2WYL
PDB:
2WYM
PFAM:
PF13483
PRIDE:
P39300
REFSEQ:
NP_418613
SMR:
P39300
UNIPROT:
P39300


Operon      
Name: ulaG         
Operon arrangement:
Transcription unit        Promoter
ulaG


Transcriptional Regulation      
Display Regulation             
Repressed by: IHF, UlaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ulaRp5 4418562 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Campos E., Aguilar J., Baldoma L., Badia J., 2002, The gene yjfQ encodes the repressor of the yjfR-X regulon (ula), which is involved in L-ascorbate metabolism in Escherichia coli., J Bacteriol 184(21):6065-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB