RegulonDB RegulonDB 10.9: Gene Form
   

ytfP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tamB ytfP yzfA chpS chpB tamA anti-anti-terminator anti-terminator terminator terminator anti-terminator anti-anti-terminator TSS_5078 TSS_5078 chpSp2 chpSp2 chpSp1 chpSp1 yzfAp2 yzfAp2 TSS_5077 TSS_5077 TSS_5076 TSS_5076

Gene      
Name: ytfP    Texpresso search in the literature
Synonym(s): ECK4218, G7876, b4222
Genome position(nucleotides): 4447894 --> 4448235 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.46
External database links:  
ASAP:
ABE-0013814
ECHOBASE:
EB2408
ECOLIHUB:
ytfP
OU-MICROARRAY:
b4222
STRING:
511145.b4222
COLOMBOS: ytfP


Product      
Name: γ-glutamylamine cyclotransferase family protein YtfP
Synonym(s): YtfP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.866
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
3 -> 109 IFVYGSLRHKQGNSHWMTNAQLLGDFSIDNYQLYSLGHYPGAVPGNGTVHGEVYRIDNATLAELDALRTRGGEYARQLIQTPYGSAWMYVYQRPVDGLKLIESGDWL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0061929 - gamma-glutamylaminecyclotransferase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7876-MONOMER
ECOLIWIKI:
b4222
INTERPRO:
IPR036568
INTERPRO:
IPR039126
INTERPRO:
IPR009288
INTERPRO:
IPR013024
MODBASE:
P0AE48
PANTHER:
PTHR12510
PDB:
1XHS
PFAM:
PF06094
PRIDE:
P0AE48
REFSEQ:
NP_418643
SMR:
P0AE48
SWISSMODEL:
P0AE48
UNIPROT:
P0AE48


Operon      
Name: tamAB-ytfP         
Operon arrangement:
Transcription unit        Promoter
tamAB-ytfP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5076 4445404 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5077 4447908 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5078 4448430 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB