RegulonDB RegulonDB 10.9: Gene Form
   

insI3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insI3 fecE yjhV insM yjhE yjhD ythA terminator anti-terminator anti-anti-terminator anti-anti-terminator anti-terminator terminator terminator terminator terminator insIp5 insIp5 TSS_5123 TSS_5123

Gene      
Name: insI3    Texpresso search in the literature
Synonym(s): ECK0258, G7905, b4284, tra8-3
Genome position(nucleotides): 4507466 <-- 4508617 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.83
External database links:  
ASAP:
ABE-0014045
ECOLIHUB:
insI-3
OU-MICROARRAY:
b4284
STRING:
511145.b4284
COLOMBOS: insI3


Product      
Name: KpLE2 phage-like element; IS30 transposase
Synonym(s): InsI3, Tra8-3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.281
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
58 -> 98 HLTLSEREEIRAGLSAKMSIRAIATALNRSPSTISREVQRN
213 -> 379 VNGTPIHERSRNIDNRRSLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIERGV
230 -> 320 SLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-4233
ECOLIWIKI:
b4284
INTERPRO:
IPR001598
INTERPRO:
IPR036397
INTERPRO:
IPR025246
INTERPRO:
IPR012337
INTERPRO:
IPR001584
PFAM:
PF00665
PFAM:
PF13936
PRIDE:
P0CF90
PROSITE:
PS01043
PROSITE:
PS50994
REFSEQ:
NP_418704
UNIPROT:
P0CF90


Operon      
Name: insMI3         
Operon arrangement:
Transcription unit        Promoter
insMI3


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5123 4507785 forward nd [RS-EPT-CBR] [1]
  promoter insIp5 4508686 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB