RegulonDB RegulonDB 10.9: Gene Form
   

insA7 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjhU insB7 insA7 ykiE insAp13 insAp13 insAp14 insAp14 TSS_5124 TSS_5124

Gene      
Name: insA7    Texpresso search in the literature
Synonym(s): ECK0023, G7908, b4294
Genome position(nucleotides): 4518527 --> 4518802 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.9
External database links:  
ASAP:
ABE-0014077
ECHOBASE:
EB4743
ECOLIHUB:
insA-7
OU-MICROARRAY:
b4294
STRING:
511145.b4294
COLOMBOS: insA7


Product      
Name: KpLE2 phage-like element; IS1 repressor protein InsA
Synonym(s): InsA7
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.925
Isoelectric point: 11.242
Motif(s):
 
Type Positions Sequence
43 -> 88 FTYTASQPGKHQKIIDMAMNGVGCRASARIMGVGLNTVLRHLKNSG
1 -> 36 MASISIRCPSCSATEGVVRNGKSTAGHQRYLCSPCR

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Umeda M., et al., 1991
External database links:  
ECOCYC:
G7908-MONOMER
ECOLIWIKI:
b4294
INTERPRO:
IPR024431
INTERPRO:
IPR003220
PFAM:
PF03811
PFAM:
PF12759
PRIDE:
P19767
PRODB:
PRO_000023015
REFSEQ:
NP_418714
UNIPROT:
P19767


Operon      
Name: insA7         
Operon arrangement:
Transcription unit        Promoter
insA-7


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5124 4518374 forward nd [RS-EPT-CBR] [2]
  promoter insAp14 4518379 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter insAp13 4518442 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Umeda M., Ohtsubo E., 1991, Four types of IS1 with differences in nucleotide sequence reside in the Escherichia coli K-12 chromosome., Gene 98(1):1-5

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB