RegulonDB RegulonDB 10.10: Gene Form
   

yjiX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btsT yjiA yjiX yjiAp7 yjiAp7 yjiAp6 yjiAp6

Gene      
Name: yjiX    Texpresso search in the literature
Synonym(s): ECK4343, G7941, b4353
Genome position(nucleotides): 4588876 <-- 4589079 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.49
External database links:  
ASAP:
ABE-0014276
ECHOBASE:
EB2471
ECOLIHUB:
yjiX
OU-MICROARRAY:
b4353
STRING:
511145.b4353
COLOMBOS: yjiX


Product      
Name: PF04328 family protein YjiX
Synonym(s): YjiX
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.729
Isoelectric point: 8.682
Motif(s):
 
Type Positions Sequence
5 -> 67 LGQAKKYLGQAAKMLIGIPDYDNYVEHMKTNHPDKPYMSYEEFFRERQNARYGGDGKGGMRCC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7941-MONOMER
ECOLIWIKI:
b4353
INTERPRO:
IPR007423
PANTHER:
PTHR38453
PFAM:
PF04328
PRIDE:
P0ADC8
REFSEQ:
NP_418773
UNIPROT:
P0ADC8


Operon      
Name: yjiXA         
Operon arrangement:
Transcription unit        Promoter
yjiXA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiAp6 4588995 reverse nd [ICWHO] [1]
  promoter yjiAp7 4589048 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB