RegulonDB RegulonDB 10.8: Gene Form
   

hcaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaE hcaR hcaF hcaC iroK hcaB HcaR hcaEp hcaEp hcaRp hcaRp hcaTp7 hcaTp7

Gene      
Name: hcaE    Texpresso search in the literature
Synonym(s): ECK2535, M009, b2538, digA, hcaA, hcaA1, phdC1, yfhU
Genome position(nucleotides): 2669032 --> 2670393 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.94
External database links:  
ASAP:
ABE-0008355
ECHOBASE:
EB3229
OU-MICROARRAY:
b2538
PortEco:
hcaE
STRING:
511145.b2538
COLOMBOS: hcaE


Product      
Name: putative 3-phenylpropionate/cinnamate dioxygenase subunit α
Synonym(s): 3-phenylpropionate dioxygenase, alpha; subunit, 3-phenylpropionate dioxygenase, large subunit, DigA, HcaA, HcaA1, HcaE, YfhU
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 51.109
Isoelectric point: 5.118
Motif(s):
 
Type Positions Sequence
20 -> 20 V
384 -> 453 GHRARNSKLCLEMGLGQEKRRDDGIPGITNYIFSETAARGMYQRWADLLSSESWQEVLDKTAAYQQEVMK
44 -> 142 LFLAHESQIPKPGDFFNTYMGEDAVVVVRQKDGSIKAFLNQCRHRAMRVSYADCGNTRAFTCPYHGWSYGINGELIDVPLEPRAYPQGLCKSHWGLNEV
163 -> 433 LRDYLGDIAWYLDGMLDRREGGTEIVGGVQKWVINCNWKFPAEQFASDQYHALFSHASAVQVLGAKDDGSDKRLGDGQTARPVWETAKDALQFGQDGHGSGFFFTEKPDANVWVDGAVSSYYRETYAEAEQRLGEVRALRLAGHNNIFPTLSWLNGTATLRVWHPRGPDQVEVWAFCITDKAASDEVKAAFENSATRAFGPAGFLEQDDSENWCEIQKLLKGHRARNSKLCLEMGLGQEKRRDDGIPGITNYIFSETAARGMYQRWADLLS
43 -> 125 WLFLAHESQIPKPGDFFNTYMGEDAVVVVRQKDGSIKAFLNQCRHRAMRVSYADCGNTRAFTCPYHGWSYGINGELIDVPLEP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0051213 - dioxygenase activity
GO:0008695 - 3-phenylpropionate dioxygenase activity
biological_process GO:0044237 - cellular metabolic process
GO:0019439 - aromatic compound catabolic process
GO:0055114 - oxidation-reduction process
GO:0019380 - 3-phenylpropionate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
PHENYLPRODIOXY-MONOMER
ECOLIWIKI:
b2538
INTERPRO:
IPR020875
INTERPRO:
IPR036922
INTERPRO:
IPR017941
INTERPRO:
IPR015881
INTERPRO:
IPR015879
INTERPRO:
IPR001663
MODBASE:
P0ABR5
PFAM:
PF00848
PFAM:
PF00355
PRIDE:
P0ABR5
PRINTS:
PR00090
PRODB:
PRO_000022861
PROSITE:
PS51296
PROSITE:
PS00570
REFSEQ:
NP_417033
SMR:
P0ABR5
UNIPROT:
P0ABR5


Operon      
Name: hcaEFCBD         
Operon arrangement:
Transcription unit        Promoter
hcaEFCBD


Transcriptional Regulation      
Display Regulation             
Activated by: HcaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hcaTp7 2668053 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB