RegulonDB RegulonDB 10.8: Gene Form
   

hcaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hcaE hcaR hcaB hcaF hcaC iroK HcaR hcaEp hcaEp hcaRp hcaRp hcaTp7 hcaTp7

Gene      
Name: hcaF    Texpresso search in the literature
Synonym(s): ECK2536, M015, b2539, digB, hcaA, hcaA2, hcaB, phdC2, yfhV
Genome position(nucleotides): 2670390 --> 2670908 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.22
External database links:  
ASAP:
ABE-0008357
ECHOBASE:
EB3230
OU-MICROARRAY:
b2539
PortEco:
hcaF
STRING:
511145.b2539
COLOMBOS: hcaF


Product      
Name: putative 3-phenylpropionate/cinnamate dioxygenase subunit β
Synonym(s): 3-phenylpropionate dioxygenase, beta; subunit, 3-phenylpropionate dioxygenase, small subunit, DigB, HcaA, HcaA2, HcaB, HcaF, YfhV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.579
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
49 -> 49 N
19 -> 164 HEASLLDDWKFRDWLAQLDEEIRYTMRTTVNAQTRDRRKGVQPPTTWIFNDTKDQLERRIARLETGMAWAEEPPSRTRHLISNCQISETDIPNVFAVRVNYLLYRAQKERDETFYVGTRFDKVRRLEDDNWRLLERDIVLDQAVIT
11 -> 11 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0051213 - dioxygenase activity
GO:0008695 - 3-phenylpropionate dioxygenase activity
biological_process GO:0006725 - cellular aromatic compound metabolic process
GO:0019439 - aromatic compound catabolic process
GO:0055114 - oxidation-reduction process
GO:0019380 - 3-phenylpropionate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
HCAA2-MONOMER
ECOLIWIKI:
b2539
INTERPRO:
IPR023712
INTERPRO:
IPR032710
INTERPRO:
IPR000391
MODBASE:
Q47140
PANTHER:
PTHR41534
PFAM:
PF00866
PRIDE:
Q47140
PRODB:
PRO_000022862
REFSEQ:
NP_417034
SMR:
Q47140
UNIPROT:
Q47140


Operon      
Name: hcaEFCBD         
Operon arrangement:
Transcription unit        Promoter
hcaEFCBD


Transcriptional Regulation      
Display Regulation             
Activated by: HcaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hcaTp7 2668053 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB