RegulonDB RegulonDB 10.9: Gene Form
   

atpI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atpB rsmG atpI atpIp atpIp TSS_4344 TSS_4344 atpBp1 atpBp1 atpBp2 atpBp2 TSS_4343 TSS_4343 TSS_4342 (cluster) TSS_4342 (cluster) TSS_4341 (cluster) TSS_4341 (cluster) TSS_4340 (cluster) TSS_4340 (cluster) TSS_4339 (cluster) TSS_4339 (cluster) TSS_4338 (cluster) TSS_4338 (cluster) TSS_4337 (cluster) TSS_4337 (cluster) TSS_4336 TSS_4336 TSS_4335 TSS_4335 TSS_4334 TSS_4334 TSS_4333 TSS_4333 TSS_4332 (cluster) TSS_4332 (cluster) TSS_4331 TSS_4331 TSS_4330 (cluster) TSS_4330 (cluster)

Gene      
Name: atpI    Texpresso search in the literature
Synonym(s): ECK3732, EG10106, b3739, uncI
Genome position(nucleotides): 3922060 <-- 3922440 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0012224
CGSC:
18511
ECHOBASE:
EB0104
ECOLIHUB:
atpI
OU-MICROARRAY:
b3739
STRING:
511145.b3739
COLOMBOS: atpI


Product      
Name: ATP synthase accessory factor AtpI
Synonym(s): AtpI, UncI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 13.632
Isoelectric point: 12.164
Motif(s):
 
Type Positions Sequence
38 -> 58 VSAISGGLAVFLPNVLFMIFA
71 -> 94 VAWTFAFGEAFKVLAMLVLLVVAL
2 -> 126 SVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRHQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAVINNKG
13 -> 108 KLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRHQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTW
101 -> 117 FLPLIVTWVLVLVVQIL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.8 - ATP proton motive force interconversion
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.2 - The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Su
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0045263 - proton-transporting ATP synthase complex, coupling factor F(o)
biological_process GO:0006811 - ion transport
Note(s): Note(s): ...[more].
Reference(s): [1] Brusilow WS., et al., 1983
[2] Hartmann C., et al., 2011
[3] Kasimoglu E., et al., 1996
[4] Porter AC., et al., 1983
[5] Schneppe B., et al., 1991
[6] Schneppe B., et al., 1990
[7] von Meyenburg K., et al., 1982
External database links:  
ECOCYC:
EG10106-MONOMER
ECOLIWIKI:
b3739
INTERPRO:
IPR005598
PFAM:
PF03899
PRIDE:
P0ABC0
PRODB:
PRO_000022194
REFSEQ:
NP_418195
UNIPROT:
P0ABC0


Operon      
Name: atpIBEFHAGDC         
Operon arrangement:
Transcription unit        Promoter
atpBEFHAGDC
atpBEFHAGDC
atpIBEFHAGDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4330 (cluster) 3921379 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4331 3921382 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4332 (cluster) 3921385 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4333 3921390 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4334 3921401 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4335 3921709 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4336 3921775 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4337 (cluster) 3921812 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4338 (cluster) 3921818 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4339 (cluster) 3921823 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4340 (cluster) 3921829 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4341 (cluster) 3922078 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4342 (cluster) 3922116 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_4343 3922124 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_4344 3922273 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Brusilow WS., Porter AC., Simoni RD., 1983, Cloning and expression of uncI, the first gene of the unc operon of Escherichia coli., J Bacteriol 155(3):1265-70

 [2] Hartmann C., Engel A., 2011, Cloning, expression, purification, and characterization of the membrane protein UncI from Escherichia coli., Protein Expr Purif 79(2):187-90

 [3] Kasimoglu E., Park SJ., Malek J., Tseng CP., Gunsalus RP., 1996, Transcriptional regulation of the proton-translocating ATPase (atpIBEFHAGDC) operon of Escherichia coli: control by cell growth rate., J Bacteriol 178(19):5563-7

 [4] Porter AC., Brusilow WS., Simoni RD., 1983, Promoter for the unc operon of Escherichia coli., J Bacteriol 155(3):1271-8

 [5] Schneppe B., Deckers-Hebestreit G., Altendorf K., 1991, Detection and localization of the i protein in Escherichia coli cells using antibodies., FEBS Lett 292(1-2):145-7

 [6] Schneppe B., Deckers-Hebestreit G., Altendorf K., 1990, Overproduction and purification of the uncI gene product of the ATP synthase of Escherichia coli., J Biol Chem 265(1):389-95

 [7] von Meyenburg K., Jorgensen BB., Nielsen J., Hansen FG., 1982, Promoters of the atp operon coding for the membrane-bound ATP synthase of Escherichia coli mapped by Tn10 insertion mutations., Mol Gen Genet 188(2):240-8

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB