RegulonDB RegulonDB 10.10: Gene Form
   

cytR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

priA cytR ftsN CRP CytR CytR CytR cytRp cytRp TSS_4638 TSS_4638

Gene      
Name: cytR    Texpresso search in the literature
Synonym(s): ECK3926, EG10200, b3934
Genome position(nucleotides): 4123431 <-- 4124456 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.05
External database links:  
ASAP:
ABE-0012853
CGSC:
887
ECHOBASE:
EB0196
ECOLIHUB:
cytR
OU-MICROARRAY:
b3934
STRING:
511145.b3934
COLOMBOS: cytR


Product      
Name: DNA-binding transcriptional repressor CytR
Synonym(s): CytR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 37.82
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
10 -> 64 ATMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLPQPMGRNVKR
176 -> 337 VNYLYEQGHKRIGCIAGPEEMPLCHYRLQGYVQALRRCGIMVDPQYIARGDFTFEAGSKAMQQLLDLPQPPTAVFCHSDVMALGALSQAKRQGLKVPEDLSIIGFDNIDLTQFCDPPLTTIAQPRYEIGREAMLLLLDQMQGQHVGSGSRLMDCELIIRGST
11 -> 56 TMKDVALKAKVSTATVSRALMNPDKVSQATRNRVEKAAREVGYLPQ
12 -> 31 MKDVALKAKVSTATVSRALM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription cis-regulatory region binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Reference(s): [1] Gerlach P., et al., 1990
[2] Lee EH., et al., 1990
[3] Plunkett G., et al., 1993
[4] Valentin-Hansen P., et al., 1986
External database links:  
DIP:
DIP-9390N
ECOCYC:
PD04028
ECOLIWIKI:
b3934
INTERPRO:
IPR000843
INTERPRO:
IPR010982
INTERPRO:
IPR028082
MODBASE:
P0ACN7
PDB:
2LCV
PFAM:
PF00356
PFAM:
PF13377
PRIDE:
P0ACN7
PRODB:
PRO_000022391
PROSITE:
PS00356
PROSITE:
PS50932
REFSEQ:
NP_418369
SMART:
SM00354
SMR:
P0ACN7
UNIPROT:
P0ACN7


Operon      
Name: cytR         
Operon arrangement:
Transcription unit        Promoter
cytR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4638 4123524 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gerlach P., Valentin-Hansen P., Bremer E., 1990, Transcriptional regulation of the cytR repressor gene of Escherichia coli: autoregulation and positive control by the cAMP/CAP complex., Mol Microbiol 4(3):479-88

 [2] Lee EH., Masai H., Allen GC., Kornberg A., 1990, The priA gene encoding the primosomal replicative n' protein of Escherichia coli., Proc Natl Acad Sci U S A 87(12):4620-4

 [3] Plunkett G., Burland V., Daniels DL., Blattner FR., 1993, Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes., Nucleic Acids Res 21(15):3391-8

 [4] Valentin-Hansen P., Larsen JE., Hojrup P., Short SA., Barbier CS., 1986, Nucleotide sequence of the CytR regulatory gene of E. coli K-12., Nucleic Acids Res 14(5):2215-28

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB