RegulonDB RegulonDB 10.9: Gene Form
   

dnaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaC dnaT yjjA yjjAp1 yjjAp1 yjjAp8 yjjAp8

Gene      
Name: dnaC    Texpresso search in the literature
Synonym(s): ECK4351, EG10237, b4361, dnaD
Genome position(nucleotides): 4600238 <-- 4600975 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.54
External database links:  
ASAP:
ABE-0014304
CGSC:
849
ECHOBASE:
EB0233
ECOLIHUB:
dnaC
OU-MICROARRAY:
b4361
STRING:
511145.b4361
COLOMBOS: dnaC


Product      
Name: DNA replication protein DnaC
Synonym(s): DnaC, DnaD, chromosome replication; initiation and chain elongation
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.935
Isoelectric point: 9.399
Motif(s):
 
Type Positions Sequence
44 -> 239 LERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYEKVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:1990077 - primosome complex
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006260 - DNA replication
GO:0006269 - DNA replication, synthesis of RNA primer
GO:0006271 - DNA strand elongation involved in DNA replication
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Davey MJ., et al., 2003
[2] Kobori JA., et al., 1982
[3] Schaeffer PM., et al., 2005
[4] Wahle E., et al., 1989
External database links:  
DIP:
DIP-9457N
ECOCYC:
EG10237-MONOMER
ECOLIWIKI:
b4361
INTERPRO:
IPR028350
INTERPRO:
IPR027417
INTERPRO:
IPR003593
INTERPRO:
IPR002611
MODBASE:
P0AEF0
PDB:
6QEM
PDB:
6QEL
PDB:
6KZA
PFAM:
PF01695
PRIDE:
P0AEF0
PRODB:
PRO_000022461
REFSEQ:
NP_418781
SMART:
SM00382
SMR:
P0AEF0
UNIPROT:
P0AEF0


Operon      
Name: yjjB-dnaTC-yjjA         
Operon arrangement:
Transcription unit        Promoter
dnaTC
dnaTC-yjjA
yjjB-dnaTC
yjjB-dnaTC-yjjA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjjAp8 4600210 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter yjjAp1 4600337 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Davey MJ., O'Donnell M., 2003, Replicative helicase loaders: ring breakers and ring makers., Curr Biol 13(15):R594-6

 [2] Kobori JA., Kornberg A., 1982, The Escherichia coli dnaC gene product. II. Purification, physical properties, and role in replication., J Biol Chem 257(22):13763-9

 [3] Schaeffer PM., Headlam MJ., Dixon NE., 2005, Protein--protein interactions in the eubacterial replisome., IUBMB Life 57(1):5-12

 [4] Wahle E., Lasken RS., Kornberg A., 1989, The dnaB-dnaC replication protein complex of Escherichia coli. II. Role of the complex in mobilizing dnaB functions., J Biol Chem 264(5):2469-75

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB