RegulonDB RegulonDB 10.9: Gene Form
   

glpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpD glpG glpE GlpR GlpR GlpR GlpR CRP glpDp glpDp glpEp glpEp glpGp glpGp glpRp1 glpRp1 glpRp2 glpRp2

Gene      
Name: glpE    Texpresso search in the literature
Synonym(s): ECK3411, EG10395, b3425
Genome position(nucleotides): 3561497 <-- 3561823 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.52
External database links:  
ASAP:
ABE-0011182
CGSC:
18265
ECHOBASE:
EB0390
ECOLIHUB:
glpE
OU-MICROARRAY:
b3425
STRING:
511145.b3425
COLOMBOS: glpE


Shine dalgarno      
Sequence: tttgtaaagaAAGAGAgacgCAT


Product      
Name: thiosulfate sulfurtransferase GlpE
Synonym(s): GlpE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.082
Isoelectric point: 4.291
Motif(s):
 
Type Positions Sequence
11 -> 98 DAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQR
108 -> 108 A
17 -> 105 QEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQFPAEVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0004792 - thiosulfate sulfurtransferase activity
biological_process GO:0006071 - glycerol metabolic process
GO:0006791 - sulfur utilization
External database links:  
ECOCYC:
EG10395-MONOMER
ECOLIWIKI:
b3425
INTERPRO:
IPR036873
INTERPRO:
IPR023695
INTERPRO:
IPR001763
MODBASE:
P0A6V5
PDB:
1GN0
PDB:
1GMX
PFAM:
PF00581
PRIDE:
P0A6V5
PRODB:
PRO_000022796
PROSITE:
PS50206
REFSEQ:
NP_417883
SMART:
SM00450
SMR:
P0A6V5
UNIPROT:
P0A6V5


Operon      
Name: glpEGR         
Operon arrangement:
Transcription unit        Promoter
glpR
glpR
glpGR
glpEGR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB