RegulonDB RegulonDB 10.8: Gene Form
   

kefC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kefC yaaU kefF folA IHF TyrR TyrR folAp folAp TSS_82 TSS_82 kefFp2 kefFp2

Gene      
Name: kefC    Texpresso search in the literature
Synonym(s): ECK0048, EG10521, b0047, trkC
Genome position(nucleotides): 47769 --> 49631 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.5
External database links:  
ASAP:
ABE-0000161
CGSC:
82
ECHOBASE:
EB0516
OU-MICROARRAY:
b0047
PortEco:
kefC
STRING:
511145.b0047
COLOMBOS: kefC


Product      
Name: K+ : H+ antiporter KefC
Synonym(s): KefC, TrkC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 67.796
Isoelectric point: 5.842
Motif(s):
 
Type Positions Sequence
449 -> 450 DA
26 -> 46 LGLGSVLGYLIAGCIIGPWGL
90 -> 110 GALQMVICGGLLGLFCMLLGL
149 -> 169 FAVLLFQDIAAIPLVAMIPLL
401 -> 523 RVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLESAGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERETFEGAL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0008324 - cation transmembrane transporter activity
GO:0019899 - enzyme binding
GO:0015297 - antiporter activity
GO:0015643 - toxic substance binding
GO:0000166 - nucleotide binding
GO:0015079 - potassium ion transmembrane transporter activity
GO:0015299 - solute:proton antiporter activity
GO:0015503 - glutathione-regulated potassium exporter activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006811 - ion transport
GO:0006812 - cation transport
GO:0006813 - potassium ion transport
GO:0009636 - response to toxic substance
GO:0051595 - response to methylglyoxal
GO:0006885 - regulation of pH
GO:0055085 - transmembrane transport
GO:0071805 - potassium ion transmembrane transport
GO:1902600 - proton transmembrane transport
GO:0098655 - cation transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10072N
ECOCYC:
KEFC-MONOMER
ECOLIWIKI:
b0047
INTERPRO:
IPR006036
INTERPRO:
IPR038770
INTERPRO:
IPR036291
INTERPRO:
IPR023941
INTERPRO:
IPR006153
INTERPRO:
IPR004771
INTERPRO:
IPR003148
MINT:
MINT-1257196
MODBASE:
P03819
PANTHER:
PTHR46157:SF3
PDB:
3EYW
PDB:
3L9W
PDB:
3L9X
PFAM:
PF00999
PFAM:
PF02254
PRIDE:
P03819
PRINTS:
PR00335
PRODB:
PRO_000023062
PROSITE:
PS51201
REFSEQ:
NP_414589
SMR:
P03819
UNIPROT:
P03819


Operon      
Name: kefFC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter kefFp2 47080 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_82 47215 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB