RegulonDB RegulonDB 10.9: Gene Form
   

mprA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrA mprA ygaH ygaZ MprA terminator anti-terminator anti-anti-terminator TSS_2996 TSS_2996 mprAp mprAp

Gene      
Name: mprA    Texpresso search in the literature
Synonym(s): ECK2678, EG10603, b2684, emrR
Genome position(nucleotides): 2810770 --> 2811300 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.15
External database links:  
ASAP:
ABE-0008834
CGSC:
33255
ECHOBASE:
EB0598
ECOLIHUB:
mprA
OU-MICROARRAY:
b2684
STRING:
511145.b2684
COLOMBOS: mprA


Product      
Name: DNA-binding transcriptional repressor MprA
Synonym(s): EmrR, MprA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MarR
Cellular location: cytosol
Molecular weight: 20.563
Isoelectric point: 6.16
Motif(s):
 
Type Positions Sequence
53 -> 112 INETLFMALITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIERRESDNDRRC
26 -> 160 EILLTRLCMHMQSKLLENRNKMLKAQGINETLFMALITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIERRESDNDRRCLHLQLTEKGHEFLREVLPPQHNCLHQLWSALSTTEKDQLEQITRKLLS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  8 - extrachromosomal --> 8.2 - plasmid related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
External database links:  
DIP:
DIP-10248N
ECOCYC:
EG10603-MONOMER
ECOLIWIKI:
b2684
INTERPRO:
IPR000835
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR023187
MODBASE:
P0ACR9
PFAM:
PF01047
PRIDE:
P0ACR9
PRINTS:
PR00598
PRODB:
PRO_000023279
PROSITE:
PS01117
PROSITE:
PS50995
REFSEQ:
NP_417169
SMART:
SM00347
SMR:
P0ACR9
UNIPROT:
P0ACR9


Operon      
Name: mprA-emrAB         
Operon arrangement:
Transcription unit        Promoter
emrRAB


Transcriptional Regulation      
Display Regulation             
Repressed by: MprA
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| exponential phase
E: Escherichia coli| LB medium| nalidixic acid 160 µM| exponential phase

[2] 

C: Escherichia coli| LB medium| exponential phase
E: Escherichia coli| LB medium| CCCP 10 µM| exponential phase

[3] 

C: Escherichia coli| LB medium| exponential phase
E: Escherichia coli| LB medium| ethidium bromide 250 µM| exponential phase

[4] 

C: Escherichia coli| LB medium| exponential phase
E: Escherichia coli| LB medium| DNP 0.5 mM| exponential phase

[5] 

C: Escherichia coli| LB medium| exponential phase
E: Escherichia coli| LB medium| salicylate 5 mM| exponential phase

[6] 

C: Escherichia coli| LB medium| exponential phase
E: Escherichia coli| LB medium| tetrachlorosalicylanilide 10 µM| exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2996 2811338 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muńiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB