RegulonDB RegulonDB 10.10: Gene Form
   

recJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recJ prfB dsbC TSS_3165 TSS_3165 TSS_3164 TSS_3164 TSS_3163 TSS_3163 TSS_3162 (cluster) TSS_3162 (cluster) TSS_3161 TSS_3161 TSS_3160 TSS_3160 TSS_3159 TSS_3159 TSS_3158 TSS_3158

Gene      
Name: recJ    Texpresso search in the literature
Synonym(s): ECK2887, EG10830, b2892
Genome position(nucleotides): 3036373 <-- 3038106 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
 56.63
External database links:  
ASAP:
 ABE-0009492
CGSC:
 17965
ECHOBASE:
 EB0823
ECOLIHUB:
 recJ
OU-MICROARRAY:
 b2892
STRING:
 511145.b2892
COLOMBOS: recJ


Product      
Name: ssDNA-specific exonuclease RecJ
Synonym(s): RecJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 63.389
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
20 -> 20 A
74 -> 201 IIVVGDFDADGATSTALSVLAMRSLGCSNIDYLVPNRFEDGYGLSPEVVDQAHARGAQLIVTVDNGISSHAGVEHARSLGIPVIVTDHHLPGDTLPAAEAIINPNLRDCNFPSKSLAGVGVAFYLMLA
469 -> 572 DGPLSPAEMTMEVAQLLRDAGPWGQMFPEPLFDGHFRLLQQRLVGERHLKVMVEPVGGGPLLDGIAFNVDTALWPDNGVREVQLAYKLDINEFRGNRSLQIIID
6 -> 6 Q
322 -> 452 LDALNQTRKEIEQGMQIEALTLCEKLERSRDTLPGGLAMYHPEWHQGVVGILASRIKERFHRPVIAFAPAGDGTLKGSGRSIQGLHMRDALERLDTLYPGMMLKFGGHAMAAGLSLEEDKFKLFQQRFGEL

 
Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008409 - 5'-3' exonuclease activity
GO:0045145 - single-stranded DNA 5'-3' exodeoxyribonuclease activity
biological_process GO:0010165 - response to X-ray
GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Asai T., et al., 1994
[2] Asai T., et al., 1993
[3] Belle JJ., et al., 2007
[4] Brena-Valle M., et al., 1998
[5] Clark AJ. 1991
[6] De Septenville AL., et al., 2012
[7] Dermic D. 2006
[8] Dermic D., et al., 2006
[9] Fishel R., et al., 1989
[10] Flores MJ., et al., 2005
[11] Foster PL., et al., 1999
[12] Friedman-Ohana R., et al., 1998
[13] Gulevich EP., et al., 2011
[14] Haggerty TJ., et al., 1993
[15] Handa N., et al., 2003
[16] Handa N., et al., 2009
[17] Horii Z., et al., 1973
[18] Ishiura M., et al., 1989
[19] Ivancic-Bace I., et al., 2005
[20] Ivancic-Bace I., et al., 2006
[21] Kolodner R., et al., 1985
[22] Kurilovich E., et al., 2019
[23] Lantsov VA., et al., 1990
[24] Lanzov V., et al., 1991
[25] Lloyd RG., et al., 1987
[26] Lloyd RG., et al., 1987
[27] Lloyd RG., et al., 1988
[28] Long JE., et al., 2010
[29] Lovett ST. 2006
[30] Lovett ST., et al., 1985
[31] Lovett ST., et al., 1991
[32] Lovett ST., et al., 1988
[33] Luisi-DeLuca C., et al., 1989
[34] Mahdi AA., et al., 1989
[35] Mashimo K., et al., 2003
[36] Mosberg JA., et al., 2012
[37] Nakayama K., et al., 1988
[38] Pollard LM., et al., 2007
[39] Prada Medina CA., et al., 2016
[40] Ryder L., et al., 1994
[41] Sargentini NJ., et al., 1986
[42] Schellhorn HE., et al., 1991
[43] Serment-Guerrero J., et al., 2008
[44] Silberstein Z., et al., 1987
[45] Sukhodolets VV. 1999
[46] Thaler DS., et al., 1989
[47] Thoms B., et al., 2008
[48] Thoms B., et al., 1988
[49] Thoms B., et al., 1998
[50] Tseng YC., et al., 1994
[51] Verbenko VN., et al., 1999
[52] Vlasic I., et al., 2008
[53] Yamamoto K., et al., 1988
External database links:  
DIP:
 DIP-10654N
ECOCYC:
 EG10830-MONOMER
ECOLIWIKI:
 b2892
INTERPRO:
 IPR041122
INTERPRO:
 IPR038763
INTERPRO:
 IPR004610
INTERPRO:
 IPR003156
INTERPRO:
 IPR001667
MODBASE:
 P21893
PFAM:
 PF01368
PFAM:
 PF02272
PFAM:
 PF17768
PRIDE:
 P21893
PRODB:
 PRO_000023703
REFSEQ:
 NP_417368
SMR:
 P21893
UNIPROT:
 P21893


Operon      
Name: xerD-dsbC-recJ-prfB-lysS         
Operon arrangement:
Transcription unit        Promoter
dsbC
dsbC-recJ-prfB
xerD-dsbC-recJ
xerD-dsbC-recJ
prfB-lysS
xerD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3158 3035202 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3159 3035315 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3160 3035434 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3161 3036095 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3162 (cluster) 3036210 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3163 3036221 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3164 3036252 reverse nd [RS-EPT-CBR] [54]
  promoter TSS_3165 3036324 reverse nd [RS-EPT-CBR] [54]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


Reference(s)    

 [1] Asai T., Kogoma T., 1994, The RecF pathway of homologous recombination can mediate the initiation of DNA damage-inducible replication of the Escherichia coli chromosome., J Bacteriol 176(22):7113-4

 [2] Asai T., Sommer S., Bailone A., Kogoma T., 1993, Homologous recombination-dependent initiation of DNA replication from DNA damage-inducible origins in Escherichia coli., EMBO J 12(8):3287-95

 [3] Belle JJ., Casey A., Courcelle CT., Courcelle J., 2007, Inactivation of the DnaB helicase leads to the collapse and degradation of the replication fork: a comparison to UV-induced arrest., J Bacteriol 189(15):5452-62

 [4] Brena-Valle M., Serment-Guerrero J., 1998, SOS induction by gamma-radiation in Escherichia coli strains defective in repair and/or recombination mechanisms., Mutagenesis 13(6):637-41

 [5] Clark AJ., 1991, rec genes and homologous recombination proteins in Escherichia coli., Biochimie 73(4):523-32

 [6] De Septenville AL., Duigou S., Boubakri H., Michel B., 2012, Replication fork reversal after replication-transcription collision., PLoS Genet 8(4):e1002622

 [7] Dermic D., 2006, Functions of multiple exonucleases are essential for cell viability, DNA repair and homologous recombination in recD mutants of Escherichia coli., Genetics 172(4):2057-69

 [8] Dermic D., Zahradka D., Petranovic M., 2006, Exonuclease requirements for recombination of lambda-phage in recD mutants of Escherichia coli., Genetics 173(4):2399-402

 [9] Fishel R., Kolodner R., 1989, Gene conversion in Escherichia coli: the recF pathway for resolution of heteroduplex DNA., J Bacteriol 171(6):3046-52

 [10] Flores MJ., Sanchez N., Michel B., 2005, A fork-clearing role for UvrD., Mol Microbiol 57(6):1664-75

 [11] Foster PL., Rosche WA., 1999, Increased episomal replication accounts for the high rate of adaptive mutation in recD mutants of Escherichia coli., Genetics 152(1):15-30

 [12] Friedman-Ohana R., Cohen A., 1998, Heteroduplex joint formation in Escherichia coli recombination is initiated by pairing of a 3'-ending strand., Proc Natl Acad Sci U S A 95(12):6909-14

 [13] Gulevich EP., Kuznetsova VN., Verbenko VN., 2011, [Role of constitutive and inducible repair in radiation resistance of Escherichia coli]., Genetika 47(7):879-89

 [14] Haggerty TJ., Lovett ST., 1993, Suppression of recJ mutations of Escherichia coli by mutations in translation initiation factor IF3., J Bacteriol 175(19):6118-25

 [15] Handa N., Kobayashi I., 2003, Accumulation of large non-circular forms of the chromosome in recombination-defective mutants of Escherichia coli., BMC Mol Biol 4:5

 [16] Handa N., Morimatsu K., Lovett ST., Kowalczykowski SC., 2009, Reconstitution of initial steps of dsDNA break repair by the RecF pathway of E. coli., Genes Dev 23(10):1234-45

 [17] Horii Z., Clark AJ., 1973, Genetic analysis of the recF pathway to genetic recombination in Escherichia coli K12: isolation and characterization of mutants., J Mol Biol 80(2):327-44

 [18] Ishiura M., Hazumi N., Koide T., Uchida T., Okada Y., 1989, A recB recC sbcB recJ host prevents recA-independent deletions in recombinant cosmid DNA propagated in Escherichia coli., J Bacteriol 171(2):1068-74

 [19] Ivancic-Bace I., Salaj-Smic E., Brcic-Kostic K., 2005, Effects of recJ, recQ, and recFOR mutations on recombination in nuclease-deficient recB recD double mutants of Escherichia coli., J Bacteriol 187(4):1350-6

 [20] Ivancic-Bace I., Vlasic I., Salaj-Smic E., Brcic-Kostic K., 2006, Genetic evidence for the requirement of RecA loading activity in SOS induction after UV irradiation in Escherichia coli., J Bacteriol 188(14):5024-32

 [21] Kolodner R., Fishel RA., Howard M., 1985, Genetic recombination of bacterial plasmid DNA: effect of RecF pathway mutations on plasmid recombination in Escherichia coli., J Bacteriol 163(3):1060-6

 [22] Kurilovich E., Shiriaeva A., Metlitskaya A., Morozova N., Ivancic-Bace I., Severinov K., Savitskaya E., 2019, Genome Maintenance Proteins Modulate Autoimmunity Mediated Primed Adaptation by the Escherichia coli Type I-E CRISPR-Cas System., Genes (Basel) 10(11)

 [23] Lantsov VA., Stepanova IM., 1990, [Frequency of recombination exchanges in Escherichia coli K-12: genetic determinants controlling this frequency]., Genetika 26(12):2127-34

 [24] Lanzov V., Stepanova I., Vinogradskaja G., 1991, Genetic control of recombination exchange frequency in Escherichia coli K-12., Biochimie 73(2-3):305-12

 [25] Lloyd RG., Buckman C., Benson FE., 1987, Genetic analysis of conjugational recombination in Escherichia coli K12 strains deficient in RecBCD enzyme., J Gen Microbiol 133(9):2531-8

 [26] Lloyd RG., Evans NP., Buckman C., 1987, Formation of recombinant lacZ+ DNA in conjugational crosses with a recB mutant of Escherichia coli K12 depends on recF, recJ, and recO., Mol Gen Genet 209(1):135-41

 [27] Lloyd RG., Porton MC., Buckman C., 1988, Effect of recF, recJ, recN, recO and ruv mutations on ultraviolet survival and genetic recombination in a recD strain of Escherichia coli K12., Mol Gen Genet 212(2):317-24

 [28] Long JE., Massoni SC., Sandler SJ., 2010, RecA4142 causes SOS constitutive expression by loading onto reversed replication forks in Escherichia coli K-12., J Bacteriol 192(10):2575-82

 [29] Lovett ST., 2006, Replication arrest-stimulated recombination: Dependence on the RecA paralog, RadA/Sms and translesion polymerase, DinB., DNA Repair (Amst) 5(12):1421-7

 [30] Lovett ST., Clark AJ., 1985, Cloning of the Escherichia coli recJ chromosomal region and identification of its encoded proteins., J Bacteriol 162(1):280-5

 [31] Lovett ST., Kolodner RD., 1991, Nucleotide sequence of the Escherichia coli recJ chromosomal region and construction of recJ-overexpression plasmids., J Bacteriol 173(1):353-64

 [32] Lovett ST., Luisi-DeLuca C., Kolodner RD., 1988, The genetic dependence of recombination in recD mutants of Escherichia coli., Genetics 120(1):37-45

 [33] Luisi-DeLuca C., Lovett ST., Kolodner RD., 1989, Genetic and physical analysis of plasmid recombination in recB recC sbcB and recB recC sbcA Escherichia coli K-12 mutants., Genetics 122(2):269-78

 [34] Mahdi AA., Lloyd RG., 1989, Identification of the recR locus of Escherichia coli K-12 and analysis of its role in recombination and DNA repair., Mol Gen Genet 216(2-3):503-10

 [35] Mashimo K., Kawata M., Yamamoto K., 2003, Roles of the RecJ and RecQ proteins in spontaneous formation of deletion mutations in the Escherichia coli K12 endogenous tonB gene., Mutagenesis 18(4):355-63

 [36] Mosberg JA., Gregg CJ., Lajoie MJ., Wang HH., Church GM., 2012, Improving lambda red genome engineering in Escherichia coli via rational removal of endogenous nucleases., PLoS One 7(9):e44638

 [37] Nakayama K., Shiota S., Nakayama H., 1988, Thymineless death in Escherichia coli mutants deficient in the RecF recombination pathway., Can J Microbiol 34(7):905-7

 [38] Pollard LM., Chutake YK., Rindler PM., Bidichandani SI., 2007, Deficiency of RecA-dependent RecFOR and RecBCD pathways causes increased instability of the (GAA*TTC)n sequence when GAA is the lagging strand template., Nucleic Acids Res 35(20):6884-94

 [39] Prada Medina CA., Aristizabal Tessmer ET., Quintero Ruiz N., Serment-Guerrero J., Fuentes JL., 2016, Survival and SOS response induction in ultraviolet B irradiated Escherichia coli cells with defective repair mechanisms., Int J Radiat Biol 92(6):321-8

 [40] Ryder L., Whitby MC., Lloyd RG., 1994, Mutation of recF, recJ, recO, recQ, or recR improves Hfr recombination in resolvase-deficient ruv recG strains of Escherichia coli., J Bacteriol 176(6):1570-7

 [41] Sargentini NJ., Smith KC., 1986, Quantitation of the involvement of the recA, recB, recC, recF, recJ, recN, lexA, radA, radB, uvrD, and umuC genes in the repair of X-ray-induced DNA double-strand breaks in Escherichia coli., Radiat Res 107(1):58-72

 [42] Schellhorn HE., Low KB., 1991, Indirect stimulation of recombination in Escherichia coli K-12: dependence on recJ, uvrA, and uvrD., J Bacteriol 173(19):6192-8

 [43] Serment-Guerrero J., Brena-Valle M., Espinosa-Aguirre JJ., 2008, In vivo role of Escherichia coli single-strand exonucleases in SOS induction by gamma radiation., Mutagenesis 23(4):317-23

 [44] Silberstein Z., Cohen A., 1987, Synthesis of linear multimers of OriC and pBR322 derivatives in Escherichia coli K-12: role of recombination and replication functions., J Bacteriol 169(7):3131-7

 [45] Sukhodolets VV., 1999, [Formation of the heterozygous tandem duplication in the process of conjugation recombination in Escherichia coli: study of the effect of mutations for the recQ, uvrD, and recJ genes]., Genetika 35(4):450-8

 [46] Thaler DS., Sampson E., Siddiqi I., Rosenberg SM., Thomason LC., Stahl FW., Stahl MM., 1989, Recombination of bacteriophage lambda in recD mutants of Escherichia coli., Genome 31(1):53-67

 [47] Thoms B., Borchers I., Wackernagel W., 2008, Effects of single-strand DNases ExoI, RecJ, ExoVII, and SbcCD on homologous recombination of recBCD+ strains of Escherichia coli and roles of SbcB15 and XonA2 ExoI mutant enzymes., J Bacteriol 190(1):179-92

 [48] Thoms B., Wackernagel W., 1988, Suppression of the UV-sensitive phenotype of Escherichia coli recF mutants by recA(Srf) and recA(Tif) mutations requires recJ+., J Bacteriol 170(8):3675-81

 [49] Thoms B., Wackernagel W., 1998, Interaction of RecBCD enzyme with DNA at double-strand breaks produced in UV-irradiated Escherichia coli: requirement for DNA end processing., J Bacteriol 180(21):5639-45

 [50] Tseng YC., Hung JL., Wang TC., 1994, Involvement of RecF pathway recombination genes in postreplication repair in UV-irradiated Escherichia coli cells., Mutat Res 315(1):1-9

 [51] Verbenko VN., Krup'ian EP., Kuznetsova LV., Kalinin VL., 1999, [A mutant allele gam18, participating in the RecF repair path in Escherichia coli K-12]., Genetika 35(2):309-13

 [52] Vlasic I., Ivancic-Bace I., Imesek M., Mihaljevic B., Brcic-Kostic K., 2008, RecJ nuclease is required for SOS induction after introduction of a double-strand break in a RecA loading deficient recB mutant of Escherichia coli., Biochimie 90(9):1347-55

 [53] Yamamoto K., Takahashi N., Yoshikura H., Kobayashi I., 1988, Homologous recombination involving a large heterology in Escherichia coli., Genetics 119(4):759-69

 [54] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

RegulonDB