RegulonDB RegulonDB 10.9: Gene Form
   

xerC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrD xerC dapF yigB yigA yigE5\' LexA terminator TSS_4475 TSS_4475 TSS_4474 TSS_4474 uvrDp2 uvrDp2 uvrDp1 uvrDp1 TSS_4472 TSS_4472 TSS_4471 TSS_4471 TSS_4470 TSS_4470 TSS_4469 TSS_4469 TSS_4468 (cluster) TSS_4468 (cluster)

Gene      
Name: xerC    Texpresso search in the literature
Synonym(s): ECK3806, EG11069, b3811
Genome position(nucleotides): 3996287 --> 3997183 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.96
External database links:  
ASAP:
ABE-0012448
CGSC:
30184
ECHOBASE:
EB1062
ECOLIHUB:
xerC
OU-MICROARRAY:
b3811
STRING:
511145.b3811
COLOMBOS: xerC


Product      
Name: site-specific tyrosine recombinase
Synonym(s): XerC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.868
Isoelectric point: 9.911
Motif(s):
 
Type Positions Sequence
8 -> 90 VERYLRYLSVERQLSPITLLNYQRQLEAIINFASENGLQSWQQCDVTMVRNFAVRSRRKGLGAASLALRLSALRSFFDWLVSQ
252 -> 254 ESS
2 -> 88 TDLHTDVERYLRYLSVERQLSPITLLNYQRQLEAIINFASENGLQSWQQCDVTMVRNFAVRSRRKGLGAASLALRLSALRSFFDWLV
109 -> 288 HLPKNIDVDDMNRLLDIDINDPLAVRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRLPIGRNAVAWIEHWLDLRDLFGSEDDALFLSKLGKRISARNVQKRFAEWGIKQGLNNHVHPHKLRHSFATHMLESSGDLRGVQELLGHANLSTTQIYTHLDFQHLASVYD
184 -> 185 NA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0048476 - Holliday junction resolvase complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0009009 - site-specific recombinase activity
GO:0009037 - tyrosine-based site-specific recombinase activity
biological_process GO:0051301 - cell division
GO:0006276 - plasmid maintenance
GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0007049 - cell cycle
GO:0007059 - chromosome segregation
GO:0015074 - DNA integration
GO:0042150 - plasmid recombination
GO:0071139 - resolution of recombination intermediates
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Blakely G., et al., 1991
External database links:  
DIP:
DIP-726N
ECOCYC:
EG11069-MONOMER
ECOLIWIKI:
b3811
INTERPRO:
IPR011010
INTERPRO:
IPR013762
INTERPRO:
IPR002104
INTERPRO:
IPR004107
INTERPRO:
IPR023009
INTERPRO:
IPR011931
INTERPRO:
IPR010998
MODBASE:
P0A8P6
PDB:
5DCF
PFAM:
PF00589
PFAM:
PF02899
PRIDE:
P0A8P6
PRODB:
PRO_000024234
PROSITE:
PS51900
PROSITE:
PS51898
REFSEQ:
NP_418256
SMR:
P0A8P6
SWISSMODEL:
P0A8P6
UNIPROT:
P0A8P6


Operon      
Name: yifL-dapF-yigA-xerC-yigB         
Operon arrangement:
Transcription unit        Promoter
yifL-dapF-yigA-xerC-yigB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4468 (cluster) 3995868 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4469 3995958 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4470 3996295 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4471 3996562 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4472 3997751 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4474 3998622 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4475 3998664 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blakely G., Colloms S., May G., Burke M., Sherratt D., 1991, Escherichia coli XerC recombinase is required for chromosomal segregation at cell division., New Biol 3(8):789-98

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB